Pengzhenrongella sicca: J4E96_13820 Help Entry J4E96_13820       CDS       T07613                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism psic  Pengzhenrongella sicca Pathway psic01100   Metabolic pathways psic01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:psic00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     J4E96_13820    00074 Mycolic acid biosynthesis     J4E96_13820   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     J4E96_13820 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Ribosomal_L50 PP-binding_2 Motif Other DBs NCBI-ProteinID:  QTE28447 UniProt:  A0A8A4ZDA0 LinkDB All DBs Position 3020036..3020287 Genome browser AA seq 83 aa AA seqDB search MAFSEQEILAGLAEIVSEETGLPTDSVLPEKSFTDDLDIDSLSMMTIVTLAEEKFGVRIP DDEVKNLSSVADVVKFIAGAQAA NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atggcgttcagcgagcaggagatcctggccggactggccgagatcgtcagcgaggagacc gggcttccgacggactcggtcctgcccgagaagtccttcaccgacgacctcgacatcgac tcgctgtcgatgatgacgatcgtcacgctcgccgaggagaagttcggcgtgcgcatcccc gacgacgaggtcaagaacctctcgagcgtggctgacgtcgtcaagttcatcgcgggagcc caggcggcctag

DBGET integrated database retrieval system