Pseudomonas sichuanensis: LOY51_08015 Help Entry LOY51_08015       CDS       T08582                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism psih  Pseudomonas sichuanensis Pathway psih01100   Metabolic pathways psih01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:psih00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     LOY51_08015 (acpP)    00074 Mycolic acid biosynthesis     LOY51_08015 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     LOY51_08015 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 TerB DUF1896 Ribosomal_L50 NirdL-like_HTH Motif Other DBs NCBI-ProteinID:  UVL90824 LinkDB All DBs Position 1724643..1724879 Genome browser AA seq 78 aa AA seqDB search MSTIEERVKKIVAEQLGVKEEEVVNAASFVEDLGADSLDTVELVMALEEEFETEIPDEEA EKITTVQAAIDYVNAHQA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcaccatcgaagaacgcgtcaagaaaatcgtcgccgagcaactgggcgtcaaggaa gaggaagttgtgaatgctgcttccttcgttgaagacctgggtgccgactcgcttgacacc gttgagctggtgatggctctggaagaggaattcgagaccgaaatccctgacgaagaagcc gagaagatcactaccgttcaagctgccatcgactacgtcaacgcccaccaggcctaa

DBGET integrated database retrieval system