Pseudomonas siliginis: NF676_04510
Help
Entry
NF676_04510 CDS
T08569
Symbol
truB
Name
(GenBank) tRNA pseudouridine(55) synthase TruB
KO
K03177
tRNA pseudouridine55 synthase [EC:
5.4.99.25
]
Organism
psii
Pseudomonas siliginis
Brite
KEGG Orthology (KO) [BR:
psii00001
]
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03016 Transfer RNA biogenesis [BR:
psii03016
]
NF676_04510 (truB)
Enzymes [BR:
psii01000
]
5. Isomerases
5.4 Intramolecular transferases
5.4.99 Transferring other groups
5.4.99.25 tRNA pseudouridine55 synthase
NF676_04510 (truB)
Transfer RNA biogenesis [BR:
psii03016
]
Eukaryotic type
tRNA modification factors
Psudouridine synthases
NF676_04510 (truB)
Prokaryotic type
NF676_04510 (truB)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
TruB_N
TruB_C_2
TruB-C_2
PUA_3
Motif
Other DBs
NCBI-ProteinID:
UST80586
LinkDB
All DBs
Position
917540..918457
Genome browser
AA seq
305 aa
AA seq
DB search
MAQVKRIRRNVSGIILLDKPLGFTSNAALQKVRWLLNAEKAGHTGSLDPLATGVLPLCFG
EATKFSQYLLDSDKGYETLAQLGKTTTTADAEGEVLQERPVTVGRADVEAVLPKFRGQIS
QIPPMYSALKRDGQPLYKLARAGEVVEREPRSVTIARLELLAFEGDTARLAVDCSKGTYI
RTLVEDIGEQLGCGAYVAELRRTQAGPFTLAQTVTLEELEAVHAEGGNEAVDRFLMPSDS
GLQDWPLLHFSEASAFYWLNGQPVRAPDAPKFGMVRVQDHNGRFIGIGEVSEDGRIAPRR
LIRSE
NT seq
918 nt
NT seq
+upstream
nt +downstream
nt
gtggctcaggtcaaacgtatccgtcgtaacgtcagcggcatcattctgctcgacaagccg
ttggggttcacctccaacgctgccttgcagaaagtgcgctggctgctcaatgccgagaag
gccggacacaccggcagccttgacccgttggccaccggcgtgttgccgctgtgcttcggc
gaggcgaccaagttctcgcaatacctgctcgattccgacaagggctatgagaccctggcg
caactgggcaagaccaccaccacggccgatgccgaaggtgaggttttgcaggagcgtccg
gtgaccgttggtcgcgccgatgtcgaggcggttctgccgaaatttcgtgggcaaatcagt
cagataccgccgatgtactcggcactcaagcgtgatggccagccgctgtacaaactggca
cgtgcaggcgaagtagtggagcgcgaaccgcgttctgttactattgcgcgcttggaattg
ctggccttcgaaggcgatactgcgcggcttgcggtggactgcagcaagggcacctatatt
cggaccctggtggaggatatcggtgagcaactcggttgtggtgcgtacgtcgcagaattg
cgtcggacccaggccgggcctttcaccctggcgcagaccgtgaccctcgaagagctggaa
gcggtacatgccgaaggcggcaacgaagcggtcgatcgcttcctgatgccatcggacagc
ggcctgcaggattggccgctgctgcatttctcggaagcgagtgcgttctactggctcaac
ggccagccggtacgtgccccggatgcaccgaagttcggcatggtacgagtacaggatcac
aatggtcgcttcatcggtatcggtgaagtgagcgaagacgggcgcatcgcgccgcgtcgc
ttgattcggtcagaatga
DBGET
integrated database retrieval system