Pseudorhodoplanes sinuspersici: CAK95_25855 Help Entry CAK95_25855       CDS       T04834                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism psin  Pseudorhodoplanes sinuspersici Pathway psin01100   Metabolic pathways psin01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:psin00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     CAK95_25855    00074 Mycolic acid biosynthesis     CAK95_25855   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     CAK95_25855 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L12_N Motif Other DBs NCBI-ProteinID:  ARQ02142 UniProt:  A0A1W6ZXN3 LinkDB All DBs Position complement(5311435..5311674) Genome browser AA seq 79 aa AA seqDB search MSDISERVKKIVVEHLGVEPDKVTEQASFIDDLGADSLDTVELVMAFEEEFGCEIPDDAA ETILTVGDAVKFLEKNAKS NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgagtgacatctccgagcgagtgaagaagattgttgtggagcacctcggtgtcgagccc gacaaggtgaccgagcaggcgagctttatcgacgatctcggggcggactccctggacacg gtcgaactcgtgatggcgttcgaagaagaattcggatgcgagattccggacgacgcggct gagaccattctcaccgtcggcgatgccgtgaagttcctcgaaaagaacgccaaaagctga

DBGET integrated database retrieval system