Phocoena sinus (vaquita): 116739841 Help Entry 116739841         CDS       T07759                                  Symbol BCL2L1 Name (RefSeq) bcl-2-like protein 1 isoform X1   KO K04570   Bcl-2-like 1 (apoptosis regulator Bcl-X) Organism psiu  Phocoena sinus (vaquita) Pathway psiu01521   EGFR tyrosine kinase inhibitor resistance psiu01524   Platinum drug resistance psiu04014   Ras signaling pathway psiu04064   NF-kappa B signaling pathway psiu04115   p53 signaling pathway psiu04137   Mitophagy - animal psiu04140   Autophagy - animal psiu04151   PI3K-Akt signaling pathway psiu04210   Apoptosis psiu04215   Apoptosis - multiple species psiu04621   NOD-like receptor signaling pathway psiu04630   JAK-STAT signaling pathway psiu05012   Parkinson disease psiu05014   Amyotrophic lateral sclerosis psiu05022   Pathways of neurodegeneration - multiple diseases psiu05145   Toxoplasmosis psiu05162   Measles psiu05166   Human T-cell leukemia virus 1 infection psiu05168   Herpes simplex virus 1 infection psiu05170   Human immunodeficiency virus 1 infection psiu05200   Pathways in cancer psiu05202   Transcriptional misregulation in cancer psiu05212   Pancreatic cancer psiu05220   Chronic myeloid leukemia psiu05222   Small cell lung cancer psiu05225   Hepatocellular carcinoma psiu05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:psiu00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     116739841 (BCL2L1)    04630 JAK-STAT signaling pathway     116739841 (BCL2L1)    04064 NF-kappa B signaling pathway     116739841 (BCL2L1)    04151 PI3K-Akt signaling pathway     116739841 (BCL2L1)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     116739841 (BCL2L1)    04137 Mitophagy - animal     116739841 (BCL2L1)   09143 Cell growth and death    04210 Apoptosis     116739841 (BCL2L1)    04215 Apoptosis - multiple species     116739841 (BCL2L1)    04115 p53 signaling pathway     116739841 (BCL2L1)  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     116739841 (BCL2L1)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     116739841 (BCL2L1)    05202 Transcriptional misregulation in cancer     116739841 (BCL2L1)   09162 Cancer: specific types    05212 Pancreatic cancer     116739841 (BCL2L1)    05225 Hepatocellular carcinoma     116739841 (BCL2L1)    05220 Chronic myeloid leukemia     116739841 (BCL2L1)    05222 Small cell lung cancer     116739841 (BCL2L1)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     116739841 (BCL2L1)    05170 Human immunodeficiency virus 1 infection     116739841 (BCL2L1)    05162 Measles     116739841 (BCL2L1)    05168 Herpes simplex virus 1 infection     116739841 (BCL2L1)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     116739841 (BCL2L1)   09164 Neurodegenerative disease    05012 Parkinson disease     116739841 (BCL2L1)    05014 Amyotrophic lateral sclerosis     116739841 (BCL2L1)    05022 Pathways of neurodegeneration - multiple diseases     116739841 (BCL2L1)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     116739841 (BCL2L1)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     116739841 (BCL2L1)    01524 Platinum drug resistance     116739841 (BCL2L1)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:psiu01009]     116739841 (BCL2L1)   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:psiu03036]     116739841 (BCL2L1)   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:psiu02000]     116739841 (BCL2L1) Protein phosphatases and associated proteins [BR:psiu01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Protein phosphatase-1     PP1-interacting proteins (PIPs)      116739841 (BCL2L1) Chromosome and associated proteins [BR:psiu03036]  Eukaryotic type   Centrosome formation proteins    Other centrosome associated proteins     116739841 (BCL2L1) Transporters [BR:psiu02000]  Other transporters   Pores ion channels [TC:1]    116739841 (BCL2L1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bcl-2 BH4 Bcl-2_3 Motif Other DBs NCBI-GeneID:  116739841 NCBI-ProteinID:  XP_032460502 Ensembl:  ENSPSNG00000006945 UniProt:  A0A8C9BM97 LinkDB All DBs Position 15:26911545..26963187 Genome browser AA seq 233 aa AA seqDB search MSQSNRELVVDFLSYKLSQKGYSWSQFSDVDENRTEAPEGTESDMETPSAINGNPSWHLA DSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAY QSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIAAWMATYLNDHLEP WIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK NT seq 702 nt NT seq  +upstreamnt  +downstreamnt atgtctcagagcaatcgggagctggtggttgactttctctcctacaagctttcccagaaa ggatacagctggagtcagtttagcgatgtggacgagaacagaactgaggccccagaaggg actgaatcagacatggaaacccccagtgccatcaatggcaacccgtcctggcacctggca gacagccctgcggtgaatggagccactggccacagcagcagcttggatgcccgggaggtg atccccatggcagcggtgaagcaagcgctgagggaggcaggcgatgagtttgaactgagg taccggcgggcattcagcgacctgacatcccagctccacatcaccccagggacggcatat cagagctttgagcaggtagtgaacgaactcttccgggatggggtgaactggggtcgcatt gtggcctttttctccttcggtggggcactgtgcgtggaaagcgtagacaaggagatgcag gtattggtgagtcggattgcagcttggatggccacttacctgaatgaccacctagagcct tggatccaggagaacggcggctgggacactttcgtggaactctatgggaacaatgcagca gccgagagccgaaagggccaggagcgcttcaaccgctggttcctgacgggcatgactgtg gctggcgtggttctgctgggctcgctcttcagtcggaaatga

DBGET integrated database retrieval system