KEGG   Phocoena sinus (vaquita): 116740157
Entry
116740157         CDS       T07759                                 
Symbol
ITGAX
Name
(RefSeq) integrin alpha-X
  KO
K06462  integrin alpha X
Organism
psiu  Phocoena sinus (vaquita)
Pathway
psiu04610  Complement and coagulation cascades
psiu04810  Regulation of actin cytoskeleton
psiu05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:psiu00001]
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    116740157 (ITGAX)
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    116740157 (ITGAX)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    116740157 (ITGAX)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:psiu04515]
    116740157 (ITGAX)
   04090 CD molecules [BR:psiu04090]
    116740157 (ITGAX)
Cell adhesion molecules [BR:psiu04515]
 Integrins
  Integrin alpha subunits
   116740157 (ITGAX)
CD molecules [BR:psiu04090]
 Proteins
  116740157 (ITGAX)
SSDB
Motif
Pfam: VWA Integrin_alpha2 FG-GAP VWA_2 FG-GAP_3 Integrin_alpha FG-GAP_2
Other DBs
NCBI-GeneID: 116740157
NCBI-ProteinID: XP_032461364
Ensembl: ENSPSNG00000012838
LinkDB
Position
15:72841860..72861991
AA seq 1167 aa
MPMPDLPVMTRTRIFLLLSMALASSFCFNLDIDQPTTFHVDSAGFGYSVVQYANWLVVGA
PQEIKASNQTGGLYQCDYSMGKCEPILLPVPPEAVNMSLGLSMVATTSPFRLLACGPTVH
HACRKNMHLTGFCFLLVSPSRQAQRIPAALQECPRQEQDIAFLIDGSGSISSTNFAKMLN
FVKAMMSQFQSPSSQFSLVQFSNKFQVHFTFKAFAASSNPLSLLNSVQKLSGYTYTATAI
KMVTGQLFSALYGARKDASKILIVITDGQKKHDPLDYKDVIPSAEAAGVIRYAIGVGLAF
QNIHSWQELKDIASKPSHEHIFKVENFDALRDIQNQLKEKIFAIEGMKTTSSSSFELEMS
QEGFSAVFMPDGPVLGAVGSFSWSGGAFLYPPNRSPTFINMSQEHADMSDSYLGYSTELA
VWKGVHSLVLGAPRHQHTGKVVIFTQVSGQWRPKAEVTGTQIGSYFGASLSSVDVDRDGS
SDLVLIGAPHYYEQSRGGQVSVCPFPRGRAKWQCGAVLRGEQGHPWARFGAALTVLGDVN
GDRLTDVAIGAPGEQENRGAVYLFHGTSGLGISPAHSQRVTGTQFSPSLQYFGQSLSGGQ
DLTMDGLVDLAVGARGHALLLRTRPVLRVWANIHITPPEITRSVYECHQQPAFAQSLGEA
IVCLRVSQSPKNRLANLQSVVTFDLTLDPGRLSPRAVFEETRTRNLTRVRDLGLTQHCEP
VRLLLPACVEDPVTPIILRLNFSLVGKPASGFGNLQPMLAVDAQRYFMTSLPFEKNCGAD
HVCQDDLGISFGVSGLKTLIVGSNLELNLEVRVWNDGEDSYGTTITFFYPPGLSYRRVAG
GQNQLQSRALRLTCDSAPTGSQGTLSTSCSITNLIFREGAQITFRAIFDVSPTAMLGGRL
LLAANVSSENNAPKMSKTTFRLELPVKYAVYTVISSHEQSTKYLNFSASEEEESSGAQHR
YQVNNLGHRDLPVSIDFSVPVELNRLTVWEDMEVLHPQNPSIQCSSERTVPTESDFLTHF
QKKPVLDCSIAACLRFRCDIRSFGVQEELDFILKGNLSFGWVSQTLQKKVLVVSVAEITF
NRSVYSQLPGQEAFLRAQMELVLEKSEVYNPIPIIVGSSVGGLLLLALITAILYKVGFFK
RQYKEMMEGANGQTAPENGTGDPQVAQ
NT seq 3504 nt   +upstreamnt  +downstreamnt
atgcccatgcctgaccttccagtcatgaccaggaccaggattttcctcctcctgtcgatg
gccctggcttcctctttctgcttcaacttggacatagaccagccaacaaccttccatgtg
gacagcgctgggtttggatacagcgtggtccagtatgccaactggctggtggttggagcc
ccccaggagataaaggcttccaatcaaacgggtggcctctaccagtgcgactacagcatg
ggcaagtgtgaacccatcctccttccggtgcctccagaggctgtgaacatgtccctgggc
ctgtccatggtggccaccaccagcccctttcggctgctggcctgtggccccaccgtgcac
catgcatgcaggaagaacatgcacttgactgggttttgcttcctgctggtctccccatca
cggcaggcccagaggatcccggctgccctgcaggagtgcccgaggcaggagcaggacatt
gccttcctgattgatggttcaggcagcatctcctccaccaattttgccaaaatgctgaac
ttcgtgaaggctatgatgagccagttccagagtcccagctcccagttctccctggtgcag
ttctccaacaagttccaggtgcacttcactttcaaagctttcgcagccagctcaaaccca
ctaagcctgctgaactccgtacagaagctgagtgggtacacgtacacggccacagccatc
aagatggtcacaggacagctgttcagtgccttatatggggcccgaaaagatgcctccaaa
atcctcatcgtcatcaccgatgggcagaaaaaacatgaccctctggattacaaggacgtc
attcccagtgccgaggctgctggcgtcatccgctatgcaatcggggtgggattggctttt
caaaatatacattcctggcaagaattaaaggacatcgcatcgaagccctcccatgaacat
atatttaaagtggagaactttgatgctttgagagacattcaaaaccaactgaaagagaaa
atctttgccattgagggtatgaagactacaagcagtagttccttcgaactggagatgtcc
caggagggcttcagtgctgtgttcatgcctgatggaccagttctgggggcagtggggagc
ttcagctggtctggaggtgccttcctgtaccccccaaataggagccccaccttcatcaac
atgtctcaggagcacgcagacatgagtgactcttacctgggttactccacagagctggcc
gtttggaagggggtacacagcctggtcctgggggccccccgccatcagcacaccgggaag
gttgtcatcttcacgcaggtgtccgggcaatggaggccgaaggctgaagtcacagggacc
cagatcggctcctacttcggggcctccctcagctccgtggacgtggacagagatggcagc
tctgacctggtcctcatcggggccccccattactatgagcagagccggggcgggcaggtg
tccgtgtgcccctttcctcgggggagggctaagtggcagtgtggtgctgtcctgcgaggg
gagcaaggccacccctgggcccgctttggggcagctctgacagtgctgggggatgtgaac
ggggacaggctgacggacgtggccatcggggccccgggagagcaggagaaccggggtgct
gtctacctgtttcacggaacctcgggactgggcatcagccccgcccacagccagcgggtc
acaggcacccagttctcccccagcctccagtattttgggcagtcgctgagcgggggtcag
gacctcaccatggatggactggtggacttggctgtgggggcccgggggcacgcgctgctg
ctcaggaccagacctgtgcttagggtgtgggcaaacatccacatcacaccgccagagatc
accaggtctgtgtatgaatgccaccagcagccggccttcgcccagtctctgggtgaggcc
attgtctgccttcgtgtttctcaaagtcccaagaaccggctggctaacctccaaagcgtt
gtgacctttgacctaacccttgaccctggccgcctgagtcctcgtgctgtcttcgaggag
acaaggactcggaatctgactcgtgttcgagatctggggctgacacaacactgtgagccc
gtgaggttgcttctgccggcctgtgtggaggacccggtgacccccatcatcttgcgtctc
aacttctccctagtgggcaagcctgcctctggctttggaaacctccagcctatgctggca
gtggatgcccagagatacttcatgacctctctccccttcgagaagaactgtggtgccgat
cacgtctgccaggacgaccttggcatctcctttggggtctcaggcttgaagaccctgatt
gtggggagtaacctggagctgaacttggaagtgagagtgtggaatgatggagaggactcc
tatggaaccacaatcaccttcttctacccaccggggctatcttaccgacgtgtggcaggg
gggcagaaccagctgcagtcacgtgccctgcgcctgacctgtgacagtgcccccaccggg
agccagggcaccctcagcaccagctgtagcatcaccaacttaatcttccgtgagggcgcc
cagatcaccttcagggccatctttgacgtctcccccacggccatgctgggaggccggctg
cttcttgcagccaatgtaagcagtgagaataacgcccccaagatgagcaagaccaccttc
cggctggagctcccggtgaagtacgccgtgtacaccgtgatcagcagccatgaacaatcc
accaagtacctcaacttctcagcctctgaggaggaggaaagcagcggggctcagcacaga
taccaggtgaacaacctgggacacagggacctgcctgtcagcattgacttctcagtgccc
gtggagctgaaccggttgaccgtgtgggaggatatggaggtcctccaccctcagaaccca
tccattcagtgctcttcagagagaacagtgcccacagaatccgacttcctgacccacttt
cagaagaagcctgtcctggactgctctattgctgcctgcctgaggttccgctgtgatatc
cgctccttcggtgtccaggaggaacttgacttcatcctgaaaggaaatctcagcttcggc
tgggtcagccagacactgcagaagaaggtgttggttgtgagtgtagctgagatcacgttc
aacagatccgtgtattcccagcttccaggacaggaggcatttttgagagcccagatggag
ctggtgctggagaagtctgaggtctataaccccatccccattattgtgggcagctctgtg
ggaggactgctgctgctggctctcatcacagccatactgtacaaggttggcttcttcaaa
cgtcaatacaaggaaatgatggagggagcaaatggacagactgctccagaaaatgggaca
ggagacccccaagttgcccagtaa

DBGET integrated database retrieval system