Phocoena sinus (vaquita): 116740440 Help Entry 116740440         CDS       T07759                                  Name (RefSeq) elongin-B-like   KO K03873   elongin-B Organism psiu  Phocoena sinus (vaquita) Pathway psiu04066   HIF-1 signaling pathway psiu04120   Ubiquitin mediated proteolysis psiu05170   Human immunodeficiency virus 1 infection psiu05200   Pathways in cancer psiu05211   Renal cell carcinoma Brite KEGG Orthology (KO) [BR:psiu00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     116740440  09130 Environmental Information Processing   09132 Signal transduction    04066 HIF-1 signaling pathway     116740440  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     116740440   09162 Cancer: specific types    05211 Renal cell carcinoma     116740440   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     116740440  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:psiu04121]     116740440    03400 DNA repair and recombination proteins [BR:psiu03400]     116740440 Ubiquitin system [BR:psiu04121]  Ubiquitin ligases (E3)   Multi subunit Ring-finger type E3    Cul2 complex     Adoptor protein      116740440    Cul5 complex      116740440 DNA repair and recombination proteins [BR:psiu03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      116740440 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Motif Other DBs NCBI-GeneID:  116740440 NCBI-ProteinID:  XP_032461977 LinkDB All DBs Position 15:37151675..37152633 Genome browser AA seq 167 aa AA seqDB search MAAFATELNGDHVKNQARRGGAGPPGSGTLGASVCAARKGAELPASRRGEAVAGVDVFLK IRRRKTIIFMEGKASSTMFLLKRIVEGILKQLPDEQRLYKDHRFLDDGKILGECGFTSQT QPRVGLALQAGEAFETLPIKPFSSLPELPDVMKPQDPGSSANEQAVP NT seq 504 nt NT seq  +upstreamnt  +downstreamnt atggctgcttttgctacagagttgaatggagaccacgtgaaaaatcaagccaggcgaggc ggggcggggccgccaggttcgggcaccctgggggccagcgtgtgcgctgccaggaagggg gcggagcttccggctagtcgaaggggagaggcggtagccggtgtggacgtgttcctcaaa atacggcgccgcaagaccatcatcttcatggaaggcaaagcgtccagcaccatgttcctg ttgaagcgcatcgtcgagggcatcctcaagcagctgccagacgagcagcggctgtacaag gaccaccggtttctggacgatggcaagatattgggtgagtgtggcttcaccagccagacc cagccgcgggtggggctagccttacaggcaggtgaagcatttgagaccctgcccatcaag cccttctccagcctaccggagttgccggatgtgatgaagccgcaggacccaggaagcagc gctaatgaacaagctgtgccatga

DBGET integrated database retrieval system