Phocoena sinus (vaquita): 116740720 Help Entry 116740720         CDS       T07759                                  Symbol ELOB Name (RefSeq) elongin-B   KO K03873   elongin-B Organism psiu  Phocoena sinus (vaquita) Pathway psiu04066   HIF-1 signaling pathway psiu04120   Ubiquitin mediated proteolysis psiu05170   Human immunodeficiency virus 1 infection psiu05200   Pathways in cancer psiu05211   Renal cell carcinoma Brite KEGG Orthology (KO) [BR:psiu00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     116740720 (ELOB)  09130 Environmental Information Processing   09132 Signal transduction    04066 HIF-1 signaling pathway     116740720 (ELOB)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     116740720 (ELOB)   09162 Cancer: specific types    05211 Renal cell carcinoma     116740720 (ELOB)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     116740720 (ELOB)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:psiu04121]     116740720 (ELOB)    03400 DNA repair and recombination proteins [BR:psiu03400]     116740720 (ELOB) Ubiquitin system [BR:psiu04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      116740720 (ELOB)    Cul5 complex      116740720 (ELOB) DNA repair and recombination proteins [BR:psiu03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      116740720 (ELOB) SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Rad60-SLD Motif Other DBs NCBI-GeneID:  116740720 NCBI-ProteinID:  XP_032462477 Ensembl:  ENSPSNG00000018783 UniProt:  A0A8C9CPW4 LinkDB All DBs Position 15:51941897..51946444 Genome browser AA seq 118 aa AA seqDB search MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGEC GFTSQTARPQAPATVGLAFRADEAFEALRIEPFSSPPELPDVMKPQDSGSSANEQAVQ NT seq 357 nt NT seq  +upstreamnt  +downstreamnt atggacgtgttcctcatgatccggcgccacaagaccaccatcttcacggacgccaaggag tcgagcactgtgttcgagctaaagcgcatcgtcgagggcatcctcaagcggccgccggac gagcagcggctgtacaaggacgaccagcttctggacgacggaaagacattgggcgagtgt ggcttcaccagccagacagcacggcctcaggccccagccactgtggggctagccttcagg gcagatgaggcctttgaggccctgcgcatcgagcccttctccagcccacccgagctgccg gatgtgatgaagccacaggactcaggaagcagcgccaatgaacaagctgtgcagtga

DBGET integrated database retrieval system