Phocoena sinus (vaquita): 116743141 Help Entry 116743141         CDS       T07759                                  Symbol HMGB1 Name (RefSeq) high mobility group protein B1   KO K10802   high mobility group protein B1 Organism psiu  Phocoena sinus (vaquita) Pathway psiu03410   Base excision repair psiu04140   Autophagy - animal psiu04217   Necroptosis psiu04613   Neutrophil extracellular trap formation Brite KEGG Orthology (KO) [BR:psiu00001]  09120 Genetic Information Processing   09124 Replication and repair    03410 Base excision repair     116743141 (HMGB1)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     116743141 (HMGB1)   09143 Cell growth and death    04217 Necroptosis     116743141 (HMGB1)  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     116743141 (HMGB1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:psiu03036]     116743141 (HMGB1)    03400 DNA repair and recombination proteins [BR:psiu03400]     116743141 (HMGB1)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:psiu04147]     116743141 (HMGB1) Chromosome and associated proteins [BR:psiu03036]  Eukaryotic type   Nucleosome assembly factors    HMG (high mobility group) proteins     116743141 (HMGB1) DNA repair and recombination proteins [BR:psiu03400]  Eukaryotic type   SSBR (single strand breaks repair)    BER (base exicision repair)     Other BER factors      116743141 (HMGB1)    MMR (mismatch excision repair)     Other MMR factors      116743141 (HMGB1) Exosome [BR:psiu04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    116743141 (HMGB1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  HMG_box_2 HMG_box HMG_WDHD1 NOA36 HMG_box_5 Nop14 Motif Other DBs NCBI-GeneID:  116743141 NCBI-ProteinID:  XP_032467313 Ensembl:  ENSPSNG00000012042 UniProt:  A0A8C9CDP5 LinkDB All DBs Position 18:complement(7263736..7270547) Genome browser AA seq 215 aa AA seqDB search MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKF EDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGL SIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEK SKKKKEEEEDEEDEEDEEEEEDEEDEEEEEDDDDE NT seq 648 nt NT seq  +upstreamnt  +downstreamnt atgggcaaaggagatcctaagaagccgagaggcaaaatgtcatcatatgcattctttgtg caaacttgccgggaggagcacaagaagaagcacccagatgcttctgtcaacttctcagag ttttctaagaagtgctcagagaggtggaagaccatgtctgctaaagagaaaggaaagttt gaagacatggcaaaggcggacaaggcccgttatgaaagagaaatgaaaacttatatccct cctaaaggggagacaaaaaagaagttcaaggatcccaatgcacccaagaggcctccttcg gcctttttcttgttttgttctgagtatcgtccaaaaatcaaaggagaacatcctggccta tccattggtgatgttgcaaagaaactgggagagatgtggaataacactgctgcagatgac aagcagccctatgagaagaaggctgctaaactgaaggaaaagtacgaaaaggatattgct gcataccgagctaaagggaagcctgatgcagcaaaaaagggagtcgtcaaggctgaaaaa agcaagaaaaagaaggaagaggaggaagatgaggaagatgaagaggatgaggaggaggag gaggatgaagaggatgaagaggaagaagaagatgatgatgatgaataa

DBGET integrated database retrieval system