Phocoena sinus (vaquita): 116743415 Help Entry 116743415         CDS       T07759                                  Name (RefSeq) probable protein BRICK1   KO K05752   chromosome 3 open reading frame 10 Organism psiu  Phocoena sinus (vaquita) Pathway psiu04810   Regulation of actin cytoskeleton psiu05132   Salmonella infection Brite KEGG Orthology (KO) [BR:psiu00001]  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     116743415  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     116743415 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Other DBs NCBI-GeneID:  116743415 NCBI-ProteinID:  XP_032467673 LinkDB All DBs Position 19:complement(44936022..44936198) Genome browser AA seq 58 aa AA seqDB search MVGQEDPVQREVHQDGASWEYTEVITSSSKKTADFLHSGLATPNEKLTALEQRIEYTE NT seq 177 nt NT seq  +upstreamnt  +downstreamnt atggtgggacaagaggatccagtgcagcgcgaggttcaccaggacggggcgagctgggag tacactgaggtcatcaccagcagcagcaagaaaactgcagactttctccactcaggactc gcaacaccaaacgagaaactgacagctcttgaacagagaatagagtacactgaatga

DBGET integrated database retrieval system