Phocoena sinus (vaquita): 116745469 Help Entry 116745469         CDS       T07759                                  Symbol PFN1 Name (RefSeq) profilin-1   KO K05759   profilin Organism psiu  Phocoena sinus (vaquita) Pathway psiu04015   Rap1 signaling pathway psiu04810   Regulation of actin cytoskeleton psiu05014   Amyotrophic lateral sclerosis psiu05132   Salmonella infection Brite KEGG Orthology (KO) [BR:psiu00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     116745469 (PFN1)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     116745469 (PFN1)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     116745469 (PFN1)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     116745469 (PFN1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:psiu04131]     116745469 (PFN1)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:psiu04812]     116745469 (PFN1)    04147 Exosome [BR:psiu04147]     116745469 (PFN1) Membrane trafficking [BR:psiu04131]  Others   Actin-binding proteins    Others     116745469 (PFN1) Cytoskeleton proteins [BR:psiu04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      116745469 (PFN1) Exosome [BR:psiu04147]  Exosomal proteins   Proteins found in most exosomes    116745469 (PFN1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Profilin Pombe_5TM Motif Other DBs NCBI-GeneID:  116745469 NCBI-ProteinID:  XP_032472113 LinkDB All DBs Position 20:complement(9654658..9658087) Genome browser AA seq 140 aa AA seqDB search MAGWNAYIENLMADGVCQDAAIVGYKDSPSVWAAVPGKTFVNITPAEVGTLVGKDRSSFF VNGLTLGGQKCSVIRDSLMQEGEFTMDLRTKSTSGAPTFNITVTLTTKTLVLLMGKEGIH GGTINKKCHEMASHLRRSQY NT seq 423 nt NT seq  +upstreamnt  +downstreamnt atggccggctggaacgcctatatcgaaaacctcatggcggacggggtgtgtcaggacgcg gccatcgtgggctataaggactcgccctccgtctgggccgccgtccccgggaagaccttc gtcaacatcacgccagctgaggttggtaccctggttggcaaagaccggtcaagttttttc gtgaatgggctaacgcttgggggccagaaatgttctgtgatccgggactcactgatgcag gaaggggaatttaccatggatcttcgtaccaagagcaccagcggagcccccaccttcaat atcactgtcaccctgactaccaagacgctagtcctgctgatgggcaaagaaggtatccac ggtggtacgatcaacaagaaatgtcatgaaatggcctcccacctgcggcgttcccagtac tga

DBGET integrated database retrieval system