Phocoena sinus (vaquita): 116747882 Help Entry 116747882         CDS       T07759                                  Name (RefSeq) cofilin-1-like   KO K05765   cofilin Organism psiu  Phocoena sinus (vaquita) Pathway psiu04360   Axon guidance psiu04666   Fc gamma R-mediated phagocytosis psiu04810   Regulation of actin cytoskeleton psiu05133   Pertussis psiu05170   Human immunodeficiency virus 1 infection Brite KEGG Orthology (KO) [BR:psiu00001]  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     116747882  09150 Organismal Systems   09151 Immune system    04666 Fc gamma R-mediated phagocytosis     116747882   09158 Development and regeneration    04360 Axon guidance     116747882  09160 Human Diseases   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     116747882   09171 Infectious disease: bacterial    05133 Pertussis     116747882  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:psiu04131]     116747882   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:psiu04812]     116747882    04147 Exosome [BR:psiu04147]     116747882 Membrane trafficking [BR:psiu04131]  Others   Actin-binding proteins    Others     116747882 Cytoskeleton proteins [BR:psiu04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     ADF / Cofilin      116747882 Exosome [BR:psiu04147]  Exosomal proteins   Proteins found in most exosomes    116747882 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Cofilin_ADF Motif Other DBs NCBI-GeneID:  116747882 NCBI-ProteinID:  XP_032476398 LinkDB All DBs Position X:complement(78767904..78768446) Genome browser AA seq 152 aa AA seqDB search MFNDMMMCKLSTPEEVKKDKKVVLFCLSEDKKNIILEEGKEILVGDVGQTVDDPYATFVK MLPDKACHYVLYEAIYETKESKKEDLVFIFWTPECAPLKSKMMYGSSKDAIKKKMTEIKM NYKQTCKEVKDPCTLAEKLGSSAVLSLEGKPL NT seq 459 nt NT seq  +upstreamnt  +downstreamnt atgttcaatgacatgatgatgtgtaagttgtcaacaccagaggaggtgaagaaggacaag aaggtggtgctcttctgcctgagcgaggacaagaagaacatcatcctggaggagggcaag gagatcctggtaggtgatgtgggccagactgtagacgacccctatgccacctttgtcaag atgctgccggacaaagcctgccactacgtcctctatgaggcaatctatgagaccaaggag agcaagaaggaggacctggtgttcatcttctggacccctgagtgtgcaccccttaagagc aaaatgatgtatggcagctccaaggacgccattaagaagaagatgacggagatcaagatg aattacaagcaaacttgtaaggaggtcaaggacccctgcaccctggcagagaagctgggg agcagcgctgtcctctccctggagggcaagcctttgtga

DBGET integrated database retrieval system