Phocoena sinus (vaquita): 116748713 Help Entry 116748713         CDS       T07759                                  Symbol CALM1 Name (RefSeq) calmodulin-1 isoform X1   KO K02183   calmodulin Organism psiu  Phocoena sinus (vaquita) Pathway psiu04014   Ras signaling pathway psiu04015   Rap1 signaling pathway psiu04020   Calcium signaling pathway psiu04022   cGMP-PKG signaling pathway psiu04024   cAMP signaling pathway psiu04070   Phosphatidylinositol signaling system psiu04114   Oocyte meiosis psiu04218   Cellular senescence psiu04261   Adrenergic signaling in cardiomyocytes psiu04270   Vascular smooth muscle contraction psiu04371   Apelin signaling pathway psiu04625   C-type lectin receptor signaling pathway psiu04713   Circadian entrainment psiu04720   Long-term potentiation psiu04722   Neurotrophin signaling pathway psiu04728   Dopaminergic synapse psiu04740   Olfactory transduction psiu04744   Phototransduction psiu04750   Inflammatory mediator regulation of TRP channels psiu04910   Insulin signaling pathway psiu04912   GnRH signaling pathway psiu04915   Estrogen signaling pathway psiu04916   Melanogenesis psiu04921   Oxytocin signaling pathway psiu04922   Glucagon signaling pathway psiu04924   Renin secretion psiu04925   Aldosterone synthesis and secretion psiu04970   Salivary secretion psiu04971   Gastric acid secretion psiu05010   Alzheimer disease psiu05012   Parkinson disease psiu05022   Pathways of neurodegeneration - multiple diseases psiu05031   Amphetamine addiction psiu05034   Alcoholism psiu05133   Pertussis psiu05152   Tuberculosis psiu05163   Human cytomegalovirus infection psiu05167   Kaposi sarcoma-associated herpesvirus infection psiu05170   Human immunodeficiency virus 1 infection psiu05200   Pathways in cancer psiu05214   Glioma psiu05417   Lipid and atherosclerosis psiu05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:psiu00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     116748713 (CALM1)    04015 Rap1 signaling pathway     116748713 (CALM1)    04371 Apelin signaling pathway     116748713 (CALM1)    04020 Calcium signaling pathway     116748713 (CALM1)    04070 Phosphatidylinositol signaling system     116748713 (CALM1)    04024 cAMP signaling pathway     116748713 (CALM1)    04022 cGMP-PKG signaling pathway     116748713 (CALM1)  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     116748713 (CALM1)    04218 Cellular senescence     116748713 (CALM1)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     116748713 (CALM1)   09152 Endocrine system    04910 Insulin signaling pathway     116748713 (CALM1)    04922 Glucagon signaling pathway     116748713 (CALM1)    04912 GnRH signaling pathway     116748713 (CALM1)    04915 Estrogen signaling pathway     116748713 (CALM1)    04921 Oxytocin signaling pathway     116748713 (CALM1)    04916 Melanogenesis     116748713 (CALM1)    04924 Renin secretion     116748713 (CALM1)    04925 Aldosterone synthesis and secretion     116748713 (CALM1)   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     116748713 (CALM1)    04270 Vascular smooth muscle contraction     116748713 (CALM1)   09154 Digestive system    04970 Salivary secretion     116748713 (CALM1)    04971 Gastric acid secretion     116748713 (CALM1)   09156 Nervous system    04728 Dopaminergic synapse     116748713 (CALM1)    04720 Long-term potentiation     116748713 (CALM1)    04722 Neurotrophin signaling pathway     116748713 (CALM1)   09157 Sensory system    04744 Phototransduction     116748713 (CALM1)    04740 Olfactory transduction     116748713 (CALM1)    04750 Inflammatory mediator regulation of TRP channels     116748713 (CALM1)   09159 Environmental adaptation    04713 Circadian entrainment     116748713 (CALM1)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     116748713 (CALM1)   09162 Cancer: specific types    05214 Glioma     116748713 (CALM1)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     116748713 (CALM1)    05163 Human cytomegalovirus infection     116748713 (CALM1)    05167 Kaposi sarcoma-associated herpesvirus infection     116748713 (CALM1)   09171 Infectious disease: bacterial    05133 Pertussis     116748713 (CALM1)    05152 Tuberculosis     116748713 (CALM1)   09164 Neurodegenerative disease    05010 Alzheimer disease     116748713 (CALM1)    05012 Parkinson disease     116748713 (CALM1)    05022 Pathways of neurodegeneration - multiple diseases     116748713 (CALM1)   09165 Substance dependence    05031 Amphetamine addiction     116748713 (CALM1)    05034 Alcoholism     116748713 (CALM1)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     116748713 (CALM1)    05418 Fluid shear stress and atherosclerosis     116748713 (CALM1)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:psiu01009]     116748713 (CALM1)   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:psiu04131]     116748713 (CALM1)    03036 Chromosome and associated proteins [BR:psiu03036]     116748713 (CALM1)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:psiu04147]     116748713 (CALM1) Protein phosphatases and associated proteins [BR:psiu01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      116748713 (CALM1) Membrane trafficking [BR:psiu04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     116748713 (CALM1) Chromosome and associated proteins [BR:psiu03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      116748713 (CALM1) Exosome [BR:psiu04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    116748713 (CALM1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_9 AIF-1 EH EF_EFCAB10_C SPARC_Ca_bdg EF-hand_11 UPF0154 EFhand_Ca_insen Dockerin_1 Caleosin DUF5580_M DUF1103 FCaBP_EF-hand TerB Poly_export SPEF2_C SurA_N_3 Fe_hyd_lg_C PA_Ig-like Motif Other DBs NCBI-GeneID:  116748713 NCBI-ProteinID:  XP_032477828 Ensembl:  ENSPSNG00000021158 UniProt:  A0A8C9EAQ7 LinkDB All DBs Position 2:164789078..164800289 Genome browser AA seq 162 aa AA seqDB search MLSITTLMREFCGEADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEA ELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELR HVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAK NT seq 489 nt NT seq  +upstreamnt  +downstreamnt atgctctcgataaccactctaatgcgagaattttgcggcgaggctgatcagctgaccgaa gaacagattgctgaattcaaggaagctttctccctatttgacaaagatggcgatggcacc atcacaacaaaggaacttggaactgtcatgaggtcactgggtcagaacccaacagaagcc gaattgcaggatatgatcaacgaagtggacgctgatggtaatggcaccattgatttccca gaatttttgactatgatggctagaaaaatgaaagatacagacagtgaagaagaaatccgc gaggcattccgagtctttgacaaggatggcaatggttacatcagtgctgcagaactacgt cacgtcatgacaaacttaggagaaaaactaacagatgaagaagtagatgaaatgatcaga gaagcagatattgatggagatggacaagtcaactacgaagagttcgtacagatgatgact gcaaaatga

DBGET integrated database retrieval system