Phocoena sinus (vaquita): 116749797 Help Entry 116749797         CDS       T07759                                  Symbol NFKBIA Name (RefSeq) NF-kappa-B inhibitor alpha   KO K04734   NF-kappa-B inhibitor alpha Organism psiu  Phocoena sinus (vaquita) Pathway psiu04024   cAMP signaling pathway psiu04062   Chemokine signaling pathway psiu04064   NF-kappa B signaling pathway psiu04210   Apoptosis psiu04380   Osteoclast differentiation psiu04620   Toll-like receptor signaling pathway psiu04621   NOD-like receptor signaling pathway psiu04622   RIG-I-like receptor signaling pathway psiu04623   Cytosolic DNA-sensing pathway psiu04625   C-type lectin receptor signaling pathway psiu04657   IL-17 signaling pathway psiu04658   Th1 and Th2 cell differentiation psiu04659   Th17 cell differentiation psiu04660   T cell receptor signaling pathway psiu04662   B cell receptor signaling pathway psiu04668   TNF signaling pathway psiu04722   Neurotrophin signaling pathway psiu04920   Adipocytokine signaling pathway psiu04926   Relaxin signaling pathway psiu04931   Insulin resistance psiu04936   Alcoholic liver disease psiu05132   Salmonella infection psiu05134   Legionellosis psiu05135   Yersinia infection psiu05140   Leishmaniasis psiu05142   Chagas disease psiu05145   Toxoplasmosis psiu05160   Hepatitis C psiu05161   Hepatitis B psiu05162   Measles psiu05163   Human cytomegalovirus infection psiu05164   Influenza A psiu05166   Human T-cell leukemia virus 1 infection psiu05167   Kaposi sarcoma-associated herpesvirus infection psiu05168   Herpes simplex virus 1 infection psiu05169   Epstein-Barr virus infection psiu05170   Human immunodeficiency virus 1 infection psiu05171   Coronavirus disease - COVID-19 psiu05200   Pathways in cancer psiu05203   Viral carcinogenesis psiu05208   Chemical carcinogenesis - reactive oxygen species psiu05215   Prostate cancer psiu05220   Chronic myeloid leukemia psiu05222   Small cell lung cancer psiu05235   PD-L1 expression and PD-1 checkpoint pathway in cancer psiu05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:psiu00001]  09130 Environmental Information Processing   09132 Signal transduction    04064 NF-kappa B signaling pathway     116749797 (NFKBIA)    04668 TNF signaling pathway     116749797 (NFKBIA)    04024 cAMP signaling pathway     116749797 (NFKBIA)  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     116749797 (NFKBIA)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     116749797 (NFKBIA)    04621 NOD-like receptor signaling pathway     116749797 (NFKBIA)    04622 RIG-I-like receptor signaling pathway     116749797 (NFKBIA)    04623 Cytosolic DNA-sensing pathway     116749797 (NFKBIA)    04625 C-type lectin receptor signaling pathway     116749797 (NFKBIA)    04660 T cell receptor signaling pathway     116749797 (NFKBIA)    04658 Th1 and Th2 cell differentiation     116749797 (NFKBIA)    04659 Th17 cell differentiation     116749797 (NFKBIA)    04657 IL-17 signaling pathway     116749797 (NFKBIA)    04662 B cell receptor signaling pathway     116749797 (NFKBIA)    04062 Chemokine signaling pathway     116749797 (NFKBIA)   09152 Endocrine system    04920 Adipocytokine signaling pathway     116749797 (NFKBIA)    04926 Relaxin signaling pathway     116749797 (NFKBIA)   09156 Nervous system    04722 Neurotrophin signaling pathway     116749797 (NFKBIA)   09158 Development and regeneration    04380 Osteoclast differentiation     116749797 (NFKBIA)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     116749797 (NFKBIA)    05208 Chemical carcinogenesis - reactive oxygen species     116749797 (NFKBIA)    05203 Viral carcinogenesis     116749797 (NFKBIA)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     116749797 (NFKBIA)   09162 Cancer: specific types    05220 Chronic myeloid leukemia     116749797 (NFKBIA)    05215 Prostate cancer     116749797 (NFKBIA)    05222 Small cell lung cancer     116749797 (NFKBIA)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     116749797 (NFKBIA)    05170 Human immunodeficiency virus 1 infection     116749797 (NFKBIA)    05161 Hepatitis B     116749797 (NFKBIA)    05160 Hepatitis C     116749797 (NFKBIA)    05171 Coronavirus disease - COVID-19     116749797 (NFKBIA)    05164 Influenza A     116749797 (NFKBIA)    05162 Measles     116749797 (NFKBIA)    05168 Herpes simplex virus 1 infection     116749797 (NFKBIA)    05163 Human cytomegalovirus infection     116749797 (NFKBIA)    05167 Kaposi sarcoma-associated herpesvirus infection     116749797 (NFKBIA)    05169 Epstein-Barr virus infection     116749797 (NFKBIA)   09171 Infectious disease: bacterial    05132 Salmonella infection     116749797 (NFKBIA)    05135 Yersinia infection     116749797 (NFKBIA)    05134 Legionellosis     116749797 (NFKBIA)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     116749797 (NFKBIA)    05140 Leishmaniasis     116749797 (NFKBIA)    05142 Chagas disease     116749797 (NFKBIA)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     116749797 (NFKBIA)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     116749797 (NFKBIA)    04931 Insulin resistance     116749797 (NFKBIA)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:psiu03000]     116749797 (NFKBIA)    04131 Membrane trafficking [BR:psiu04131]     116749797 (NFKBIA) Transcription factors [BR:psiu03000]  Eukaryotic type   beta-Scaffold factors with minor groove contacts    RHR (Rel homology region) Ankyrin only     116749797 (NFKBIA) Membrane trafficking [BR:psiu04131]  Autophagy   Chaperone mediated autophagy (CMA)    Selective cargos     116749797 (NFKBIA) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ank_2 Ank Ank_3 Ank_5 Ank_4 ANK_LRRK2 Motif Other DBs NCBI-GeneID:  116749797 NCBI-ProteinID:  XP_032480450 Ensembl:  ENSPSNG00000019593 UniProt:  A0A8C9CT45 LinkDB All DBs Position 2:complement(114306756..114310338) Genome browser AA seq 314 aa AA seqDB search MFQPAEPGQEWAMEGPRDALKKERLLDDRHDSGLDSMKDEEYEQMVKELREIRLEPQEAP RGAEPWKQQVTEDGDSFLHLAIIHEEKVLTMEVVRQVKGDLAFLNFQNNLQQTPLHLAVI TNQPEVAEALLEAGCDPELRDFRGNTPLHLACEQGCLASVGVLTQPRGTQHLHSILQATN YNGHTCLHLASIHGYLGIVELLVSLGADVNAQEPCNGRTALHLAVDLQNPDLVSLLLKCG ADVNRVTYQGYSPYQLTWGRPSTRIQQQLGQLTLENLQMLPESEDEESYDTESEFTEDEL PYDDCVLGGQRLTL NT seq 945 nt NT seq  +upstreamnt  +downstreamnt atgttccagcccgcggagcccggccaggagtgggccatggagggcccccgggacgcactc aagaaggagcggctgctggacgaccgccacgacagcggcctggactccatgaaggacgag gagtacgagcagatggtgaaagagctaagggagatccgcctcgagcctcaggaggcgccg cgcggcgccgagccttggaagcagcaggtcaccgaggacggagactcgttcctgcacttg gccatcatccatgaagagaaggtgctgaccatggaagtggtccgccaagtgaagggagac ctggcgttcctcaacttccagaacaacctgcagcagactcctctccacttggcggtgatc accaaccagccagaggtcgctgaggcacttctggaagctggctgtgatcctgagctccga gactttcgaggaaatacccccttacaccttgcctgtgagcaaggctgcctggccagtgtg ggagtcctgactcagccccgtgggacccagcacctccactccatcctacaagccaccaac tacaatggtcacacgtgtctgcatttggcctctattcatggctacctgggcatcgtggag ctgttggtgtccttgggtgctgatgtcaacgcacaggagccctgcaatggccgaactgcc ctccatctcgcggttgacctgcagaatcccgacctggtgtcgctcttgttgaagtgtggg gctgacgtcaacagggtcacctaccagggctactccccataccagctcacctggggccgc ccaagcacccggatacagcagcagctgggccagctgaccctagagaaccttcagatgctg cccgagagcgaggatgaggagagctatgacacggagtcagagttcacagaggatgagctg ccctatgatgactgtgtgcttggaggccagcgcctgacgttatga

DBGET integrated database retrieval system