Phocoena sinus (vaquita): 116751037 Help Entry 116751037         CDS       T07759                                  Name (RefSeq) interleukin-3-like   KO K04736   interleukin 3 Organism psiu  Phocoena sinus (vaquita) Pathway psiu04060   Cytokine-cytokine receptor interaction psiu04151   PI3K-Akt signaling pathway psiu04210   Apoptosis psiu04630   JAK-STAT signaling pathway psiu04640   Hematopoietic cell lineage psiu04664   Fc epsilon RI signaling pathway psiu05200   Pathways in cancer psiu05202   Transcriptional misregulation in cancer psiu05221   Acute myeloid leukemia psiu05310   Asthma Brite KEGG Orthology (KO) [BR:psiu00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     116751037    04151 PI3K-Akt signaling pathway     116751037   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     116751037  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     116751037  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     116751037    04664 Fc epsilon RI signaling pathway     116751037  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     116751037    05202 Transcriptional misregulation in cancer     116751037   09162 Cancer: specific types    05221 Acute myeloid leukemia     116751037   09163 Immune disease    05310 Asthma     116751037  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:psiu04052]     116751037    00536 Glycosaminoglycan binding proteins [BR:psiu00536]     116751037 Cytokines and neuropeptides [BR:psiu04052]  Cytokines   Interleukins    116751037 Glycosaminoglycan binding proteins [BR:psiu00536]  Heparan sulfate / Heparin   Cytokines    116751037 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL3 Motif Other DBs NCBI-GeneID:  116751037 NCBI-ProteinID:  XP_032482411 LinkDB All DBs Position 3:complement(62631381..62633169) Genome browser AA seq 137 aa AA seqDB search MRSLPILHWLLFLLALHTPQAQGAPVKTPGTQQCYVLNLIREIINELDKLPVASEKTSLW RPNLEKFLTFATNSLGEDSKITKNLKEIQPILPTTMTTEEPILIEKDNLGDFRVKLKEYL SAIRDSLNCKNTQSPNV NT seq 414 nt NT seq  +upstreamnt  +downstreamnt atgcgcagcctgcccatcctgcattggctcctgttcctgcttgcactccacacccctcag gcacaaggggcaccggtcaagacaccaggaacccaacaatgctatgtactcaacctgatc cgggaaattataaatgagctagacaagctacctgtggcttcagaaaaaacaagcctctgg aggccaaacctggaaaaattcctgacatttgccacaaattcccttggagaggattcgaaa atcacgaaaaatcttaaggaaatccagccaatcctgcccacaaccatgaccacggaagag ccaatccttattgagaaggataacctgggtgatttccgggtgaaactgaaggaatatctg tctgccattagagactctctgaattgtaagaacacacagagccctaacgtctga

DBGET integrated database retrieval system