Phocoena sinus (vaquita): 116751662 Help Entry 116751662         CDS       T07759                                  Symbol IL5 Name (RefSeq) interleukin-5   KO K05428   interleukin 5 Organism psiu  Phocoena sinus (vaquita) Pathway psiu04060   Cytokine-cytokine receptor interaction psiu04630   JAK-STAT signaling pathway psiu04640   Hematopoietic cell lineage psiu04657   IL-17 signaling pathway psiu04658   Th1 and Th2 cell differentiation psiu04660   T cell receptor signaling pathway psiu04664   Fc epsilon RI signaling pathway psiu04672   Intestinal immune network for IgA production psiu05200   Pathways in cancer psiu05310   Asthma psiu05320   Autoimmune thyroid disease psiu05321   Inflammatory bowel disease psiu05330   Allograft rejection Brite KEGG Orthology (KO) [BR:psiu00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     116751662 (IL5)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     116751662 (IL5)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     116751662 (IL5)    04660 T cell receptor signaling pathway     116751662 (IL5)    04658 Th1 and Th2 cell differentiation     116751662 (IL5)    04657 IL-17 signaling pathway     116751662 (IL5)    04664 Fc epsilon RI signaling pathway     116751662 (IL5)    04672 Intestinal immune network for IgA production     116751662 (IL5)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     116751662 (IL5)   09163 Immune disease    05310 Asthma     116751662 (IL5)    05320 Autoimmune thyroid disease     116751662 (IL5)    05321 Inflammatory bowel disease     116751662 (IL5)    05330 Allograft rejection     116751662 (IL5)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:psiu04052]     116751662 (IL5)    00536 Glycosaminoglycan binding proteins [BR:psiu00536]     116751662 (IL5) Cytokines and neuropeptides [BR:psiu04052]  Cytokines   Interleukins    116751662 (IL5) Glycosaminoglycan binding proteins [BR:psiu00536]  Heparan sulfate / Heparin   Cytokines    116751662 (IL5) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL5 Motif Other DBs NCBI-GeneID:  116751662 NCBI-ProteinID:  XP_032483742 Ensembl:  ENSPSNG00000001105 UniProt:  A0A8C9AY83 LinkDB All DBs Position 3:62131292..62133703 Genome browser AA seq 135 aa AA seqDB search MRMLLHLSLLALGAVYICVIAVESPMNRLVAETLTLLSTHQTLLIGDGNLMIPTPEHTNH ELCIKEVFQGIDTLKNQTAQGDAVEKLFQNLFLIKEYIIDLQRKKCGGERWRVKQFLDYL QTFLKVINTEWTTES NT seq 408 nt NT seq  +upstreamnt  +downstreamnt atgagaatgcttctgcatttgagtttgctggctcttggagctgtctacatttgtgtcatt gctgtagaaagtcccatgaatagactggtggcagagaccttgacactgctctccactcat caaactctgctgataggtgacgggaacttgatgattcctactcccgaacatacaaatcac gaactatgcattaaagaagtctttcagggaatagacacactgaagaatcaaactgcacaa ggggatgccgtggaaaaactattccaaaacttgtttttaataaaagaatacataatagac ctccaaagaaagaagtgtggaggagaaagatggagagtaaaacaattcctagactacctg caaacttttcttaaggtgataaacaccgagtggacaacggaaagttga

DBGET integrated database retrieval system