Phocoena sinus (vaquita): 116751685 Help Entry 116751685         CDS       T07759                                  Symbol IL13 Name (RefSeq) interleukin-13   KO K05435   interleukin 13 Organism psiu  Phocoena sinus (vaquita) Pathway psiu04060   Cytokine-cytokine receptor interaction psiu04630   JAK-STAT signaling pathway psiu04657   IL-17 signaling pathway psiu04658   Th1 and Th2 cell differentiation psiu04664   Fc epsilon RI signaling pathway psiu05200   Pathways in cancer psiu05310   Asthma psiu05321   Inflammatory bowel disease Brite KEGG Orthology (KO) [BR:psiu00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     116751685 (IL13)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     116751685 (IL13)  09150 Organismal Systems   09151 Immune system    04658 Th1 and Th2 cell differentiation     116751685 (IL13)    04657 IL-17 signaling pathway     116751685 (IL13)    04664 Fc epsilon RI signaling pathway     116751685 (IL13)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     116751685 (IL13)   09163 Immune disease    05310 Asthma     116751685 (IL13)    05321 Inflammatory bowel disease     116751685 (IL13)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:psiu04052]     116751685 (IL13) Cytokines and neuropeptides [BR:psiu04052]  Cytokines   Interleukins    116751685 (IL13) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL13 Motif Other DBs NCBI-GeneID:  116751685 NCBI-ProteinID:  XP_032483787 Ensembl:  ENSPSNG00000000949 LinkDB All DBs Position 3:complement(61992404..61994761) Genome browser AA seq 145 aa AA seqDB search MRLLLTLPVALGSMALWLTVVIALTCFGGLASLGPVPPSTALKELIEELVNITQNQKAPL CNGSMVWSVNLTANMYCSALEALINVSNCSAIQRTQRMLSALCLHKPSAGQVSSEHIRDT KIEVAHFLKDLLKHSRIIFHYGKFS NT seq 438 nt NT seq  +upstreamnt  +downstreamnt atgcgtctgcttctcacgcttcctgtggctctaggctccatggcactctggttgactgtg gtcattgctctcacctgctttggtggcctcgcctccctgggccctgtgcctccctctaca gccctcaaggagctcattgaagagctggtcaatatcacccagaaccagaaggcacccctg tgcaatggcagcatggtgtggagtgtcaacctgacagccaacatgtactgttcagccctg gaagccctgatcaacgtctccaactgcagtgccatccaaaggacccagaggatgctgagc gcactctgtcttcacaagccctcagctgggcaggtttccagcgagcacatccgagacacc aaaattgaagtggcccacttcttaaaagacctgctcaaacattcaaggatcatttttcac tacggaaaattcagctga

DBGET integrated database retrieval system