Phocoena sinus (vaquita): 116752780 Help Entry 116752780         CDS       T07759                                  Symbol PFN2 Name (RefSeq) profilin-2 isoform X1   KO K05759   profilin Organism psiu  Phocoena sinus (vaquita) Pathway psiu04015   Rap1 signaling pathway psiu04810   Regulation of actin cytoskeleton psiu05014   Amyotrophic lateral sclerosis psiu05132   Salmonella infection Brite KEGG Orthology (KO) [BR:psiu00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     116752780 (PFN2)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     116752780 (PFN2)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     116752780 (PFN2)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     116752780 (PFN2)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:psiu04131]     116752780 (PFN2)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:psiu04812]     116752780 (PFN2)    04147 Exosome [BR:psiu04147]     116752780 (PFN2) Membrane trafficking [BR:psiu04131]  Others   Actin-binding proteins    Others     116752780 (PFN2) Cytoskeleton proteins [BR:psiu04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      116752780 (PFN2) Exosome [BR:psiu04147]  Exosomal proteins   Proteins found in most exosomes    116752780 (PFN2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  116752780 NCBI-ProteinID:  XP_032485554 Ensembl:  ENSPSNG00000014156 LinkDB All DBs Position 4:complement(29860270..29866912) Genome browser AA seq 140 aa AA seqDB search MAGWQSYVDNLMCDGCCQEAAIVGYCDAKYVWAATAGGVFQSITPVEIDMIVGKDREGFF TSGLTLGAKKCSVIRDSLYVDGDCTMDIRTKSQGGEPTYNVAVGRAGRALVIVMGKEGVH GGTLNKKAYELALYLRRSDV NT seq 423 nt NT seq  +upstreamnt  +downstreamnt atggccggttggcagagctacgtggataacctgatgtgcgatggctgctgccaggaggcc gccattgtcggctactgcgacgccaaatacgtatgggcagccacagccgggggcgtcttc cagagcattacgccagtagaaatagatatgattgtaggaaaggaccgggaaggtttcttt accagtggtttgactcttggcgcaaagaagtgctcagtgatcagagatagcctatacgtg gatggtgactgcacaatggacatccggacaaagagtcaaggtggggagccaacatacaac gttgccgtcggcagagctggtagagcattggttatagtcatgggaaaggaaggtgtccac ggaggcacacttaacaagaaagcatatgaactcgctttatacctgaggaggtctgatgtg taa

DBGET integrated database retrieval system