Phocoena sinus (vaquita): 116753175 Help Entry 116753175         CDS       T07759                                  Symbol MRAS Name (RefSeq) ras-related protein M-Ras   KO K07831   Ras-related protein M-Ras Organism psiu  Phocoena sinus (vaquita) Pathway psiu04010   MAPK signaling pathway psiu04014   Ras signaling pathway psiu04015   Rap1 signaling pathway psiu04072   Phospholipase D signaling pathway psiu04137   Mitophagy - animal psiu04140   Autophagy - animal psiu04218   Cellular senescence psiu04371   Apelin signaling pathway psiu04625   C-type lectin receptor signaling pathway psiu04810   Regulation of actin cytoskeleton psiu05205   Proteoglycans in cancer Brite KEGG Orthology (KO) [BR:psiu00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     116753175 (MRAS)    04014 Ras signaling pathway     116753175 (MRAS)    04015 Rap1 signaling pathway     116753175 (MRAS)    04371 Apelin signaling pathway     116753175 (MRAS)    04072 Phospholipase D signaling pathway     116753175 (MRAS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     116753175 (MRAS)    04137 Mitophagy - animal     116753175 (MRAS)   09143 Cell growth and death    04218 Cellular senescence     116753175 (MRAS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     116753175 (MRAS)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     116753175 (MRAS)  09160 Human Diseases   09161 Cancer: overview    05205 Proteoglycans in cancer     116753175 (MRAS)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04031 GTP-binding proteins [BR:psiu04031]     116753175 (MRAS) GTP-binding proteins [BR:psiu04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     116753175 (MRAS) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc GTP_EFTU Arf RsgA_GTPase MMR_HSR1 ATP_bind_1 AAA_16 MMR_HSR1_Xtn Motif Other DBs NCBI-GeneID:  116753175 NCBI-ProteinID:  XP_032486590 Ensembl:  ENSPSNG00000014460 UniProt:  A0A8C9CBZ4 LinkDB All DBs Position 4:19229589..19289591 Genome browser AA seq 208 aa AA seqDB search MATSAVPSDNLPTYKLVVVGDGGVGKSALTIQFFQKIFVPDYDPTIEDSYLKHTEIDNQW AILDVLDTAGQEEFSAMREQYMRTGDGFLIVFSVTDKASFEHVDRFHQLILRVKDRESFP MILVANKVDLMHLRKITREQGKEMATKHNIPYIETSAKDPPLNVDRAFHDLVRVIRQQIP EKSQKKKKKTKWRGDRATGTHKLQCAIL NT seq 627 nt NT seq  +upstreamnt  +downstreamnt atggcgaccagtgccgtccccagcgacaacctccccacgtacaagctggtggtggtggga gacgggggtgtgggcaagagcgccctcaccatccagtttttccagaagatctttgtgcct gactatgaccccaccatcgaagactcctacctgaagcatacagagattgacaaccagtgg gccatcttggacgttctggacacagccggacaggaggagttcagcgccatgcgggagcag tacatgcgcacgggggacggcttccttatcgtcttctcggtcacggacaaggccagcttc gagcacgtggaccgcttccaccagctcatcctgcgcgtcaaggacagggagtcattcccg atgatcctcgtggccaacaaggtcgatttgatgcatttgaggaaaatcaccagggagcaa ggaaaagaaatggccaccaaacacaatattccgtacatagaaaccagtgccaaggaccca cctctcaacgtcgacagagccttccatgacctggttagagtaattaggcaacagattccg gaaaaaagccagaagaagaagaagaaaaccaaatggcggggagaccgggccactggcacc cacaaactgcagtgcgcgatattgtga

DBGET integrated database retrieval system