KEGG   Phocoena sinus (vaquita): 116753344
Entry
116753344         CDS       T07759                                 
Symbol
MRAP
Name
(RefSeq) LOW QUALITY PROTEIN: melanocortin-2 receptor accessory protein
  KO
K22398  melanocortin 2 receptor accessory protein
Organism
psiu  Phocoena sinus (vaquita)
Pathway
psiu04927  Cortisol synthesis and secretion
psiu04934  Cushing syndrome
Brite
KEGG Orthology (KO) [BR:psiu00001]
 09150 Organismal Systems
  09152 Endocrine system
   04927 Cortisol synthesis and secretion
    116753344 (MRAP)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    116753344 (MRAP)
SSDB
Motif
Pfam: MRAP ABC2_membrane_4
Other DBs
NCBI-GeneID: 116753344
NCBI-ProteinID: XP_032486921
LinkDB
Position
4:133334051..133349493
AA seq 196 aa
MANRTNASTAYDSYEYYLDYLDLIPVDEKKLKASKHSIVIAFWVSLAAFVVFLFLLLLSM
SWPASPQTRKVRTGGGMWNSAQHHPTCPWSLGLNLPFCVWKQPQHHGAPQGPRCLYRARS
RNQVAERRAPSSSCSRRVPPPRPPPSPRATLLSSGNWPSMGTRTVPADVRNFKPSEPPLQ
TEPLDSRTNNPNQGHC
NT seq 591 nt   +upstreamnt  +downstreamnt
atggccaaccggaccaatgcctctaccgcatacgacagctacgaatactacctggactac
ttggacctcattcctgtggatgagaagaagctgaaggccagcaaacattcgatcgtcatc
gccttctgggtgagcctggcagctttcgtggtcttcctgttcttgctgctgctgtccatg
tcctggccagcctccccgcagacgaggaaagtaaggacaggcggaggtatgtggaacagt
gcccagcaccacccaacgtgcccctggagtctcggcctcaacctccccttctgtgtctgg
aagcaaccccagcatcacggggccccccaggggccccgctgcctctaccgagctcggtcg
aggaaccaggtggcagagcgtcgggccccgtccagcagctgcagcaggagagtccctcca
cctcggccccctccatcccccagagccaccctgctctcctctgggaactggccctcgatg
gggacccgcacggtaccagctgacgtcaggaacttcaagcccagtgagcctcccctgcag
acagaacctctcgacagtagaaccaacaacccaaaccagggccattgctga

DBGET integrated database retrieval system