Phocoena sinus (vaquita): 116754945 Help Entry 116754945         CDS       T07759                                  Name (RefSeq) histone H3.3A   KO K11253   histone H3 Organism psiu  Phocoena sinus (vaquita) Pathway psiu04613   Neutrophil extracellular trap formation psiu05034   Alcoholism psiu05202   Transcriptional misregulation in cancer psiu05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:psiu00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     116754945  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     116754945   09163 Immune disease    05322 Systemic lupus erythematosus     116754945   09165 Substance dependence    05034 Alcoholism     116754945  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:psiu03036]     116754945   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:psiu04147]     116754945 Chromosome and associated proteins [BR:psiu03036]  Eukaryotic type   Nucleosome assembly factors    Histones     116754945 Exosome [BR:psiu04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    116754945 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CENP-T_C PAF CENP-S CBFD_NFYB_HMF TFIID-31kDa Motif Other DBs NCBI-GeneID:  116754945 NCBI-ProteinID:  XP_032489727 Ensembl:  ENSPSNG00000003793 LinkDB All DBs Position 1:complement(162796918..162805054) Genome browser AA seq 136 aa AA seqDB search MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTE LLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTI MPKDIQLARRIRGERA NT seq 411 nt NT seq  +upstreamnt  +downstreamnt atggctcgtacaaagcagactgcccgcaaatcgaccggtggtaaagcaccgaggaagcaa ctggctacgaaagccgctcgcaagagtgcgccctctactggaggggtgaagaaacctcat cgttacaggcctggtactgtggcactccgtgaaattagacgttatcagaagtccactgaa cttctgattcgcaaacttcccttccagcgtctggtgcgggaaattgctcaggacttcaaa acagatctgcgcttccagagtgcagctattggtgctttgcaggaggcaagtgaggcctat ctggttggcctttttgaagacaccaacctgtgtgctatccatgccaaacgtgtaacgatt atgccaaaagacatccagctagcacgccgcatacgtggagaacgtgcttaa

DBGET integrated database retrieval system