Phocoena sinus (vaquita): 116755466 Help Entry 116755466         CDS       T07759                                  Name (RefSeq) interferon alpha-1-like   KO K05414   interferon alpha Organism psiu  Phocoena sinus (vaquita) Pathway psiu04060   Cytokine-cytokine receptor interaction psiu04151   PI3K-Akt signaling pathway psiu04217   Necroptosis psiu04620   Toll-like receptor signaling pathway psiu04621   NOD-like receptor signaling pathway psiu04622   RIG-I-like receptor signaling pathway psiu04623   Cytosolic DNA-sensing pathway psiu04630   JAK-STAT signaling pathway psiu04650   Natural killer cell mediated cytotoxicity psiu04936   Alcoholic liver disease psiu05152   Tuberculosis psiu05160   Hepatitis C psiu05161   Hepatitis B psiu05162   Measles psiu05163   Human cytomegalovirus infection psiu05164   Influenza A psiu05165   Human papillomavirus infection psiu05167   Kaposi sarcoma-associated herpesvirus infection psiu05168   Herpes simplex virus 1 infection psiu05169   Epstein-Barr virus infection psiu05170   Human immunodeficiency virus 1 infection psiu05171   Coronavirus disease - COVID-19 psiu05200   Pathways in cancer psiu05320   Autoimmune thyroid disease psiu05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:psiu00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     116755466    04151 PI3K-Akt signaling pathway     116755466   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     116755466  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     116755466  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     116755466    04621 NOD-like receptor signaling pathway     116755466    04622 RIG-I-like receptor signaling pathway     116755466    04623 Cytosolic DNA-sensing pathway     116755466    04650 Natural killer cell mediated cytotoxicity     116755466  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     116755466   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     116755466    05161 Hepatitis B     116755466    05160 Hepatitis C     116755466    05171 Coronavirus disease - COVID-19     116755466    05164 Influenza A     116755466    05162 Measles     116755466    05168 Herpes simplex virus 1 infection     116755466    05163 Human cytomegalovirus infection     116755466    05167 Kaposi sarcoma-associated herpesvirus infection     116755466    05169 Epstein-Barr virus infection     116755466    05165 Human papillomavirus infection     116755466   09171 Infectious disease: bacterial    05152 Tuberculosis     116755466   09163 Immune disease    05320 Autoimmune thyroid disease     116755466   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     116755466   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     116755466  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:psiu04052]     116755466 Cytokines and neuropeptides [BR:psiu04052]  Cytokines   Interferons    116755466 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Interferon CoV_NSP2_N Motif Other DBs NCBI-GeneID:  116755466 NCBI-ProteinID:  XP_032490872 Ensembl:  ENSPSNG00000001121 UniProt:  A0A8C9B6Q7 LinkDB All DBs Position 6:complement(70578733..70579907) Genome browser AA seq 189 aa AA seqDB search MAPNLSLLLALVLLSCNSNCSLGCDLPQTHSLANRRALMLLQQMRRISPFSCLKDRNDFG FPQDAFEGNQFQKAQAIAVVHEMIQQTFQLFSTEGSAAAWDETLLDKFCTALYQQLTDLQ ACLMQEAGLEGTPLLKEDSILAVRKYFHRITVYLQEKKYSPCAWEIVRAEVMRSFSSSTN LQERLRRKE NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atggccccaaacttgtctttactcctggccctggtgctactcagctgcaactccaactgc tctctgggctgcgacctgcctcagacccacagcctggctaacaggagggccctgatgctc ctgcaacaaatgaggagaatctcccccttctcctgcctgaaggacagaaatgactttgga ttcccccaggacgcgtttgaaggaaaccagttccagaaggctcaagccatcgctgtcgtc catgagatgatccagcagaccttccaactcttcagcacagagggctcggctgctgcttgg gatgagaccctcctggacaagttctgcactgcactttatcagcagctcactgacctgcaa gcctgtctgatgcaggaggcggggctggaagggactcccctgctgaaggaggactccatc ctggctgtgaggaaatacttccacagaatcactgtctatctgcaagagaagaagtacagc ccttgtgcctgggagattgtcagagcagaagtcatgagatccttctcttcatcaacaaac ttgcaagaaagactcaggaggaaggaatga

DBGET integrated database retrieval system