Phocoena sinus (vaquita): 116757391 Help Entry 116757391         CDS       T07759                                  Symbol FGF4 Name (RefSeq) fibroblast growth factor 4   KO K04358   fibroblast growth factor Organism psiu  Phocoena sinus (vaquita) Pathway psiu04010   MAPK signaling pathway psiu04014   Ras signaling pathway psiu04015   Rap1 signaling pathway psiu04020   Calcium signaling pathway psiu04151   PI3K-Akt signaling pathway psiu04810   Regulation of actin cytoskeleton psiu05200   Pathways in cancer psiu05207   Chemical carcinogenesis - receptor activation psiu05218   Melanoma psiu05224   Breast cancer psiu05226   Gastric cancer Brite KEGG Orthology (KO) [BR:psiu00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     116757391 (FGF4)    04014 Ras signaling pathway     116757391 (FGF4)    04015 Rap1 signaling pathway     116757391 (FGF4)    04020 Calcium signaling pathway     116757391 (FGF4)    04151 PI3K-Akt signaling pathway     116757391 (FGF4)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     116757391 (FGF4)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     116757391 (FGF4)    05207 Chemical carcinogenesis - receptor activation     116757391 (FGF4)   09162 Cancer: specific types    05226 Gastric cancer     116757391 (FGF4)    05218 Melanoma     116757391 (FGF4)    05224 Breast cancer     116757391 (FGF4)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:psiu04052]     116757391 (FGF4)    00536 Glycosaminoglycan binding proteins [BR:psiu00536]     116757391 (FGF4) Cytokines and neuropeptides [BR:psiu04052]  Cytokines   Growth factors (RTK binding)    116757391 (FGF4) Glycosaminoglycan binding proteins [BR:psiu00536]  Heparan sulfate / Heparin   Growth factors/receptors    116757391 (FGF4) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FGF Motif Other DBs NCBI-GeneID:  116757391 NCBI-ProteinID:  XP_032494758 Ensembl:  ENSPSNG00000016594 UniProt:  A0A8C9CBH1 LinkDB All DBs Position 8:complement(106633158..106634915) Genome browser AA seq 206 aa AA seqDB search MAGPGAAAAALLAAVLLAVLAPWAGRGGAAAPTAPNGTLEAELERRWESLVARSLARLPV AAQPKEAAVQSGAGDYLLGIKRLRRLYCNVGIGFHLQVLPDGRIGGVHADTSDSLLELSP VERGVVSIFGVAGRFFVAMSSRGKLYGSPFFTEECKFKEILLPNNYNAYECYRYPGMFIA LSKNGKTKKGSRVSPTMKVTHFLPRL NT seq 621 nt NT seq  +upstreamnt  +downstreamnt atggcggggcccggggcggccgcggcagcgctgctcgcggcggtgctgctggccgtgctg gcgccctgggccggccgagggggcgccgccgcgcccaccgcacccaacggcacgctggag gccgagctggagcgtcgctgggagagcctggtggcgcgctcgctggcgcgcctgccggtg gccgcgcagcccaaggaggctgccgtccagagcggcgccggggactacctgctgggcatc aagaggctgcggaggctctactgcaacgtgggcatcggcttccacctccaggtgctccca gacggccgcatcggcggcgtgcacgcggacacgagtgacagcctgctggagctgtcgccg gtggagcggggagtggtgagcatcttcggcgtggccggccggttcttcgtggccatgagc agcagaggcaaactctacggctcgcctttcttcaccgaggagtgcaagttcaaagagata ctcctccccaacaactacaacgcctacgagtgctacaggtaccccggcatgttcatcgcc ctaagtaagaacgggaagaccaagaaggggagccgggtgtcacccaccatgaaggtcacc catttcctccccaggctgtga

DBGET integrated database retrieval system