Phocoena sinus (vaquita): 116761128 Help Entry 116761128         CDS       T07759                                  Name (RefSeq) ras-related protein Rab-6B-like   KO K07894   Ras-related protein Rab-6B Organism psiu  Phocoena sinus (vaquita) Brite KEGG Orthology (KO) [BR:psiu00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:psiu04131]     116761128   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:psiu04147]     116761128    04031 GTP-binding proteins [BR:psiu04031]     116761128 Membrane trafficking [BR:psiu04131]  Endosome - Golgi transport   Rab GTPases and associated proteins    Rab GTPases     116761128 Exosome [BR:psiu04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    116761128 GTP-binding proteins [BR:psiu04031]  Small (monomeric) G-proteins   Rab Family    Rab6/41 [OT]     116761128 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras GTP_EFTU Motif Other DBs NCBI-GeneID:  116761128 NCBI-ProteinID:  XP_032502801 LinkDB All DBs Position 10:10965493..10965822 Genome browser AA seq 109 aa AA seqDB search MKGSPDQRIDDVRTDRGSDVIILLVGNKTDLADKWLATIREGKQRAKELSATFIETSAKT GYNVKQLFRRVASALPGMENVQEKSKEGMNDIKLDQPQESLASKGGCSR NT seq 330 nt NT seq  +upstreamnt  +downstreamnt atgaagggcagcccagaccagcggatcgatgacgtcaggacagacaggggcagtgacgtc atcatcctgctggtgggcaacaagaccgacctggccgacaagtggctggcgaccatccgg gagggcaagcagcgcgccaaagaactgagcgccacgttcatcgagaccagtgccaagacc ggctacaacgtgaagcagctcttccgacgtgtggcctcggctctgcctggaatggagaac gtccaggagaaaagcaaagaagggatgaacgacatcaagctggaccaaccccaggagtcc ctggccagcaagggcggctgctcccgctaa

DBGET integrated database retrieval system