Phocoena sinus (vaquita): 116761880 Help Entry 116761880         CDS       T07759                                  Symbol RAB7A Name (RefSeq) ras-related protein Rab-7a   KO K07897   Ras-related protein Rab-7A Organism psiu  Phocoena sinus (vaquita) Pathway psiu04137   Mitophagy - animal psiu04140   Autophagy - animal psiu04144   Endocytosis psiu04145   Phagosome psiu04148   Efferocytosis psiu05132   Salmonella infection psiu05146   Amoebiasis psiu05152   Tuberculosis Brite KEGG Orthology (KO) [BR:psiu00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     116761880 (RAB7A)    04145 Phagosome     116761880 (RAB7A)    04140 Autophagy - animal     116761880 (RAB7A)    04137 Mitophagy - animal     116761880 (RAB7A)    04148 Efferocytosis     116761880 (RAB7A)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     116761880 (RAB7A)    05152 Tuberculosis     116761880 (RAB7A)   09174 Infectious disease: parasitic    05146 Amoebiasis     116761880 (RAB7A)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:psiu04131]     116761880 (RAB7A)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:psiu04147]     116761880 (RAB7A)    04031 GTP-binding proteins [BR:psiu04031]     116761880 (RAB7A) Membrane trafficking [BR:psiu04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     116761880 (RAB7A) Exosome [BR:psiu04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    116761880 (RAB7A)   Exosomal proteins of other body fluids (saliva and urine)    116761880 (RAB7A)   Exosomal proteins of colorectal cancer cells    116761880 (RAB7A)   Exosomal proteins of bladder cancer cells    116761880 (RAB7A) GTP-binding proteins [BR:psiu04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     116761880 (RAB7A) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU RsgA_GTPase Gtr1_RagA ATP_bind_1 cobW nSTAND3 PduV-EutP Septin AAA_7 NTPase_1 AAA_22 AAA_16 AAA_24 G-alpha AAA_5 ATPase_2 NACHT AAA_14 NB-ARC SRPRB ATP-synt_ab ABC_tran Motif Other DBs NCBI-GeneID:  116761880 NCBI-ProteinID:  XP_032504166 Ensembl:  ENSPSNG00000022683 UniProt:  A0A8C9EGD2 LinkDB All DBs Position 11:1664506..1769913 Genome browser AA seq 207 aa AA seqDB search MTSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVMVDDRLVTMQ IWDTAGQERFQSLGVAFYRGADCCVLVFDVTAPNTFKTLDSWRDEFLIQASPRDPENFPF VVLGNKIDLENRQVATKRAQAWCYSKNNIPYFETSAKEAINVEQAFQTIARNALKQETEV ELYNEFPEPIKLDKNDRAKASAESCSC NT seq 624 nt NT seq  +upstreamnt  +downstreamnt atgacctcgaggaagaaagtgctactgaaggttatcatcctgggagattctggagtcggt aagacatcactcatgaaccagtacgtgaacaagaaattcagcaatcagtacaaagccaca ataggagccgacttcctgacaaaggaggtgatggtggacgacagactggttacgatgcag atctgggacacggccggacaggagaggttccagtctctgggtgtggccttctacagaggc gcagactgctgcgtgctggtgtttgacgtgactgcccccaacacgttcaaaaccctcgac agctggagagacgaattcctcatccaggccagtccccgggatcctgagaacttccccttc gttgtgctgggaaacaagattgacctcgaaaacagacaagtggccacaaagcgggcacag gcctggtgctacagcaaaaacaacattccctacttcgagaccagtgccaaggaggccatc aacgtggagcaggccttccagacgattgcccggaacgcgctgaagcaggaaacggaggtg gagctgtacaatgagttccctgagcccatcaaactggacaagaacgaccgggccaaggcc tcggcagaaagctgcagctgctga

DBGET integrated database retrieval system