Phocoena sinus (vaquita): 116762024 Help Entry 116762024         CDS       T07759                                  Symbol BRK1 Name (RefSeq) protein BRICK1   KO K05752   chromosome 3 open reading frame 10 Organism psiu  Phocoena sinus (vaquita) Pathway psiu04519   Cadherin signaling psiu04810   Regulation of actin cytoskeleton psiu05132   Salmonella infection Brite KEGG Orthology (KO) [BR:psiu00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04519 Cadherin signaling     116762024 (BRK1)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     116762024 (BRK1)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     116762024 (BRK1) SSDB OrthologParalogGFIT Motif Pfam:  CCDC53 Hydro_N_hd DUF7310 SPX Matrilin_ccoil ABC_tran_CTD LXG DUF5617 Motif Other DBs NCBI-GeneID:  116762024 NCBI-ProteinID:  XP_032504565 LinkDB All DBs Position 11:complement(6811224..6818593) Genome browser AA seq 75 aa AA seqDB search MAGQEDPVQREIHQDWANREYIEVITSSIKKIADFLNSFDMSCRSRLATLNEKLTALERR IEYIEARVTKGETLT NT seq 228 nt NT seq  +upstreamnt  +downstreamnt atggcggggcaagaggatccggtgcagcgggagattcaccaggactgggcgaaccgggag tacattgaggtcatcaccagcagcatcaagaaaatcgcagactttctcaactctttcgat atgtcttgtcgttcaagactcgcaacactaaacgagaaattgacagctcttgagcggaga atagagtacattgaagcaagggtgacaaaaggtgagaccctcacctag

DBGET integrated database retrieval system