Phocoena sinus (vaquita): 116762402 Help Entry 116762402         CDS       T07759                                  Name (RefSeq) histone H3.1   KO K11253   histone H3 Organism psiu  Phocoena sinus (vaquita) Pathway psiu04613   Neutrophil extracellular trap formation psiu05034   Alcoholism psiu05202   Transcriptional misregulation in cancer psiu05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:psiu00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     116762402  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     116762402   09163 Immune disease    05322 Systemic lupus erythematosus     116762402   09165 Substance dependence    05034 Alcoholism     116762402  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:psiu03036]     116762402   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:psiu04147]     116762402 Chromosome and associated proteins [BR:psiu03036]  Eukaryotic type   Nucleosome assembly factors    Histones     116762402 Exosome [BR:psiu04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    116762402 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CENP-S CENP-T_C CBFD_NFYB_HMF PAF YebU_pre-PUA_dom TFIID-31kDa Motif Other DBs NCBI-GeneID:  116762402 NCBI-ProteinID:  XP_032505209 Ensembl:  ENSPSNG00000005742 LinkDB All DBs Position 11:83078273..83079867 Genome browser AA seq 136 aa AA seqDB search MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTI MPKDIQLARRIRGERA NT seq 411 nt NT seq  +upstreamnt  +downstreamnt atggctcgcactaagcagaccgctcgcaagtctaccggcggcaaggcgccgcgcaagcag ctggccaccaaggcagcccggaagagtgcaccggccacgggcggcgtgaagaagccgcat cgctaccggcccggcacggtggccctgcgcgagatccgccgctaccagaagtccacagag ctgctgatccgtaagctgccgttccagcgcctggtgcgcgagatcgcgcaggacttcaag accgacctgcgcttccagagctcggccgtgatggcgctgcaggaggcgtgcgaggcctac ctggtggggctcttcgaggacaccaacctgtgtgccatccacgccaagcgcgtcactatc atgcccaaggacatccagcttgcccgtcgcatccgtggtgaaagggcgtaa

DBGET integrated database retrieval system