Phocoena sinus (vaquita): 116762417 Help Entry 116762417         CDS       T07759                                  Name (RefSeq) histone H2B type 1-M   KO K11252   histone H2B Organism psiu  Phocoena sinus (vaquita) Pathway psiu04613   Neutrophil extracellular trap formation psiu05034   Alcoholism psiu05203   Viral carcinogenesis psiu05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:psiu00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     116762417  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     116762417   09163 Immune disease    05322 Systemic lupus erythematosus     116762417   09165 Substance dependence    05034 Alcoholism     116762417  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:psiu03036]     116762417   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:psiu04147]     116762417 Chromosome and associated proteins [BR:psiu03036]  Eukaryotic type   Nucleosome assembly factors    Histones     116762417 Exosome [BR:psiu04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    116762417 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CBFD_NFYB_HMF YscO-like TFIID_20kDa Motif Other DBs NCBI-GeneID:  116762417 NCBI-ProteinID:  XP_032505227 Ensembl:  ENSPSNG00000005456 LinkDB All DBs Position 11:complement(82986971..82995924) Genome browser AA seq 126 aa AA seqDB search MPEPTKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAM GIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT KYTSSK NT seq 381 nt NT seq  +upstreamnt  +downstreamnt atgcctgaacccaccaagtccgctccggccccgaagaagggctccaagaaggcggtgacc aaggcgcagaagaaggatggcaagaagcgcaagcgcagtcgcaaggagagttactccgtg tacgtgtataaggtgctgaagcaggtccacccggacaccggcatctcgtccaaggctatg ggcatcatgaactcgttcgtcaacgacatcttcgagcgcattgcgggcgaggcgtcgcgc ctggcgcattataacaagcgctcgaccatcacttccagagagatccagacggccgtgcgc ctgctgctgcccggggagctggccaagcacgccgtgtctgagggcaccaaggctgtcacc aagtacaccagctccaagtaa

DBGET integrated database retrieval system