Phocoena sinus (vaquita): 116764130 Help Entry 116764130         CDS       T07759                                  Symbol PFN4 Name (RefSeq) profilin-4   KO K05759   profilin Organism psiu  Phocoena sinus (vaquita) Pathway psiu04015   Rap1 signaling pathway psiu04810   Regulation of actin cytoskeleton psiu05014   Amyotrophic lateral sclerosis psiu05132   Salmonella infection Brite KEGG Orthology (KO) [BR:psiu00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     116764130 (PFN4)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     116764130 (PFN4)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     116764130 (PFN4)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     116764130 (PFN4)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:psiu04131]     116764130 (PFN4)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:psiu04812]     116764130 (PFN4)    04147 Exosome [BR:psiu04147]     116764130 (PFN4) Membrane trafficking [BR:psiu04131]  Others   Actin-binding proteins    Others     116764130 (PFN4) Cytoskeleton proteins [BR:psiu04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      116764130 (PFN4) Exosome [BR:psiu04147]  Exosomal proteins   Proteins found in most exosomes    116764130 (PFN4) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  116764130 NCBI-ProteinID:  XP_032508301 Ensembl:  ENSPSNG00000006828 UniProt:  A0A8C9BI65 LinkDB All DBs Position 13:complement(18670311..18675350) Genome browser AA seq 129 aa AA seqDB search MSHLQNLLLDTLLGTKHVDNAALIKLQEQSLCVASPGFSVMPSDVRTLVDGFAKNPLKTR REGLYFKEKDYKCVRADDYSLYAKSENTGVVVVKTHLYLLVATYTEGMYPSVCVEATEKL GEYLRRKGN NT seq 390 nt NT seq  +upstreamnt  +downstreamnt atgagccatttgcagaacttactgttagatacactcctgggaacaaagcatgtagacaat gcagctctcatcaaactccaggagcagagcctatgtgtagcatcacctggatttagtgta atgcccagtgatgtccgaacacttgtggatggatttgccaagaaccctttgaaaaccaga agagaaggattgtatttcaaggagaaggactacaaatgtgtccgggcagatgactattct ctttatgctaagagtgaaaatactggtgtggttgttgtgaagacccatttgtatcttctg gtggcaacttacactgagggcatgtatcctagtgtctgtgtggaagccacagagaaattg ggagaatatctaagaagaaaaggaaattaa

DBGET integrated database retrieval system