Phocoena sinus (vaquita): 116764139 Help Entry 116764139         CDS       T07759                                  Symbol PPP3R1 Name (RefSeq) calcineurin subunit B type 1   KO K06268   serine/threonine-protein phosphatase 2B regulatory subunit Organism psiu  Phocoena sinus (vaquita) Pathway psiu04010   MAPK signaling pathway psiu04020   Calcium signaling pathway psiu04022   cGMP-PKG signaling pathway psiu04114   Oocyte meiosis psiu04218   Cellular senescence psiu04310   Wnt signaling pathway psiu04360   Axon guidance psiu04370   VEGF signaling pathway psiu04380   Osteoclast differentiation psiu04625   C-type lectin receptor signaling pathway psiu04650   Natural killer cell mediated cytotoxicity psiu04658   Th1 and Th2 cell differentiation psiu04659   Th17 cell differentiation psiu04660   T cell receptor signaling pathway psiu04662   B cell receptor signaling pathway psiu04720   Long-term potentiation psiu04724   Glutamatergic synapse psiu04921   Oxytocin signaling pathway psiu04922   Glucagon signaling pathway psiu04924   Renin secretion psiu05010   Alzheimer disease psiu05014   Amyotrophic lateral sclerosis psiu05020   Prion disease psiu05022   Pathways of neurodegeneration - multiple diseases psiu05031   Amphetamine addiction psiu05152   Tuberculosis psiu05163   Human cytomegalovirus infection psiu05166   Human T-cell leukemia virus 1 infection psiu05167   Kaposi sarcoma-associated herpesvirus infection psiu05170   Human immunodeficiency virus 1 infection psiu05235   PD-L1 expression and PD-1 checkpoint pathway in cancer psiu05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:psiu00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     116764139 (PPP3R1)    04310 Wnt signaling pathway     116764139 (PPP3R1)    04370 VEGF signaling pathway     116764139 (PPP3R1)    04020 Calcium signaling pathway     116764139 (PPP3R1)    04022 cGMP-PKG signaling pathway     116764139 (PPP3R1)  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     116764139 (PPP3R1)    04218 Cellular senescence     116764139 (PPP3R1)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     116764139 (PPP3R1)    04650 Natural killer cell mediated cytotoxicity     116764139 (PPP3R1)    04660 T cell receptor signaling pathway     116764139 (PPP3R1)    04658 Th1 and Th2 cell differentiation     116764139 (PPP3R1)    04659 Th17 cell differentiation     116764139 (PPP3R1)    04662 B cell receptor signaling pathway     116764139 (PPP3R1)   09152 Endocrine system    04922 Glucagon signaling pathway     116764139 (PPP3R1)    04921 Oxytocin signaling pathway     116764139 (PPP3R1)    04924 Renin secretion     116764139 (PPP3R1)   09156 Nervous system    04724 Glutamatergic synapse     116764139 (PPP3R1)    04720 Long-term potentiation     116764139 (PPP3R1)   09158 Development and regeneration    04360 Axon guidance     116764139 (PPP3R1)    04380 Osteoclast differentiation     116764139 (PPP3R1)  09160 Human Diseases   09161 Cancer: overview    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     116764139 (PPP3R1)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     116764139 (PPP3R1)    05170 Human immunodeficiency virus 1 infection     116764139 (PPP3R1)    05163 Human cytomegalovirus infection     116764139 (PPP3R1)    05167 Kaposi sarcoma-associated herpesvirus infection     116764139 (PPP3R1)   09171 Infectious disease: bacterial    05152 Tuberculosis     116764139 (PPP3R1)   09164 Neurodegenerative disease    05010 Alzheimer disease     116764139 (PPP3R1)    05014 Amyotrophic lateral sclerosis     116764139 (PPP3R1)    05020 Prion disease     116764139 (PPP3R1)    05022 Pathways of neurodegeneration - multiple diseases     116764139 (PPP3R1)   09165 Substance dependence    05031 Amphetamine addiction     116764139 (PPP3R1)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     116764139 (PPP3R1)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:psiu01009]     116764139 (PPP3R1) Protein phosphatases and associated proteins [BR:psiu01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      116764139 (PPP3R1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_5 EF-hand_8 EH SPARC_Ca_bdg EF-hand_9 Motif Other DBs NCBI-GeneID:  116764139 NCBI-ProteinID:  XP_032508315 Ensembl:  ENSPSNG00000017608 UniProt:  A0A8C9CQU6 LinkDB All DBs Position 13:complement(58141616..58201531) Genome browser AA seq 170 aa AA seqDB search MGNEASYPLEMCSHFDADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQQNPLVQRVID IFDTDGNGEVDFKEFIEGVSQFSVKGDKEQKLRFAFRIYDMDKDGYISNGELFQVLKMMV GNNLKDTQLQQIVDKTIINADKDGDGRISFEEFCAVVGGLDIHKKMVVDV NT seq 513 nt NT seq  +upstreamnt  +downstreamnt atgggaaatgaggcaagttatcctttggaaatgtgctcacactttgatgctgatgaaatt aaaaggctaggaaagagatttaagaagctcgatttggacaattctggttctttgagtgtg gaagagttcatgtctctgcctgagctacaacagaatcccttagtacagcgagtaatagat atatttgacacagatgggaacggagaagtagactttaaagagttcattgagggagtctct cagttcagtgtcaaaggagataaggaacagaagttgaggtttgctttccgtatctatgac atggataaagatggctatatttccaatggggaactcttccaggtgctgaagatgatggtg gggaacaatctgaaagatacacagttacagcaaatcgtggacaaaacgataataaatgca gataaggatggagatggaagaatatcctttgaagaattctgtgctgttgtaggcggcctc gatattcacaaaaagatggtggtagacgtgtga

DBGET integrated database retrieval system