Pseudomonas silvicola: LZ023_23330
Help
Entry
LZ023_23330 CDS
T10729
Name
(GenBank) AraC family transcriptional regulator
Organism
psiv Pseudomonas silvicola
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
HTH_18
HTH_AraC
AraC_binding
Motif
Other DBs
NCBI-ProteinID:
WAH55950
LinkDB
All DBs
Position
complement(5106089..5107006)
Genome browser
AA seq
305 aa
AA seq
DB search
MSSLSRVPTYGMQQRSNRDDFYIRDKHEREALTAPHRHEYFQIQINLGGDTVQHIGGAVR
PFPRNALSFILPHRLHLIPHPEHGNFMLINFAQGFLLPHLPCDPLDLEDVALDQAPELAP
FQFQEHLDFILDDPTFAKVQALLERLRELDRTRDFGTSTLLRAGLLELIGLVSRQFAEPL
QQLASERATHRGRRDALARVTAHIRAHIADPGLTLKDAAAAAFLSPNYLTHLLRKDTGST
FSELVLERRMRLARTYLLNSDEAISHIAQRCGFADEAYFSRRFRQTQGLAPGQFRRQQRA
HRADQ
NT seq
918 nt
NT seq
+upstream
nt +downstream
nt
atgtcgtccctgtcccgcgtgcccacctatggcatgcagcagcgcagcaaccgcgacgat
ttctatatccgtgacaagcacgagcgcgaagcgctgacagcgccacaccgccacgagtac
ttccagatccagatcaacctgggcggtgacaccgtgcagcatatcggcggcgccgtcagg
ccgtttccgcgcaacgccctgagcttcatcctgccccaccggctgcacctgatcccacac
cccgagcacggcaacttcatgctgatcaacttcgcccaggggtttctgttgccgcatttg
ccatgcgaccccctggacctggaagatgttgccttggatcaagcgccggagctggcaccg
ttccagtttcaggaacacctggacttcattctcgacgaccccaccttcgccaaagtgcag
gccctgctggagcgcttgcgggaactggaccgcacgcgtgacttcggcaccagcacgttg
ctgcgcgccggcctgctggagctgatcggcctggtcagccgacagttcgccgaacccctg
cagcagttggccagcgagcgtgccacccaccgcggccgccgcgacgccctggcgcgggtt
actgcccacatccgtgcgcatatcgccgatcccggcctgacgctcaaggatgccgccgcc
gcggcgttcctgtcgcccaactacctgacccacctgttgcgcaaggacaccggcagcacc
ttcagcgagctggtgctggaacggcgcatgcgcctggcgcgcacctacctgctcaacagt
gacgaggccatcagccacatcgcccaacgctgcggcttcgccgacgaagcctatttttcc
cggcgctttcgccagacccagggcttggcaccggggcaattccgccgacagcagcgcgcc
catcgggctgatcaatga
DBGET
integrated database retrieval system