Pseudomonas sp. JY-Q: AA098_17890 Help Entry AA098_17890       CDS       T09824                                  Name (GenBank) sarcosine oxidase subunit delta   KO K00304   sarcosine oxidase, subunit delta [EC:1.5.3.24 1.5.3.1] Organism psjy  Pseudomonas sp. JY-Q Pathway psjy00260   Glycine, serine and threonine metabolism psjy01100   Metabolic pathways Module psjy_M00975   Betaine degradation, bacteria, betaine => pyruvate Brite KEGG Orthology (KO) [BR:psjy00001]  09100 Metabolism   09105 Amino acid metabolism    00260 Glycine, serine and threonine metabolism     AA098_17890 Enzymes [BR:psjy01000]  1. Oxidoreductases   1.5  Acting on the CH-NH group of donors    1.5.3  With oxygen as acceptor     1.5.3.1  sarcosine oxidase (formaldehyde-forming)      AA098_17890     1.5.3.24  sarcosine oxidase (5,10-methylenetetrahydrofolate-forming)      AA098_17890 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  SoxD Motif Other DBs NCBI-ProteinID:  ANI35270 LinkDB All DBs Position 3931531..3931830 Genome browser AA seq 99 aa AA seqDB search MKVMNCPLNGPRNISEFTYGGEFKQMPDPQTCTDAEWADYVFNSDDTLGVVCEWWMHNPS SYWFLAERHTGSDEILRTFDPKELFTTRVEFTTAKETAQ NT seq 300 nt NT seq  +upstreamnt  +downstreamnt atgaaagtgatgaattgcccactcaacgggccgcgcaacatcagtgagttcacctatggc ggtgagttcaagcagatgcccgatccgcagacgtgtaccgatgccgaatgggccgactac gtgttcaacagcgatgacacgttgggcgtggtttgcgagtggtggatgcacaacccctcc agctattggttcctggccgaacgccacactggcagcgatgaaattctgcgcaccttcgat cccaaagagctgttcaccacccgtgttgaattcacgactgccaaggagaccgcgcaatga

DBGET integrated database retrieval system