Pseudomonas gorinensis: U771_02040 Help Entry U771_02040        CDS       T02969                                  Name (GenBank) glutaredoxin   KO K03676   glutaredoxin 3 Organism psk  Pseudomonas gorinensis Brite KEGG Orthology (KO) [BR:psk00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:psk03110]     U771_02040 Chaperones and folding catalysts [BR:psk03110]  Protein folding catalysts   Protein disulfide isomerase    U771_02040 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin GST_N_3 GST_N_2 Thioredoxin_2 Glrx-like GST_N DSBA Thioredoxin CLIC-like_N SH3BGR Motif Other DBs NCBI-ProteinID:  AHC32969 LinkDB All DBs Position 450242..450496 Genome browser AA seq 84 aa AA seqDB search MSQVVVYSSDWCPYCMRAKALLEKKGVAFEEIKVDGKPQVRAEMAQKAGRTSVPQIWIGT RHVGGCDDLFALERSGKLDALLHV NT seq 255 nt NT seq  +upstreamnt  +downstreamnt atgagccaggttgtcgtctattccagcgattggtgcccttactgcatgcgagccaaggct ttgctggagaaaaagggtgttgccttcgaagagatcaaggtcgacggcaagccccaggtg cgtgccgaaatggcccagaaggcggggcgcacgtccgttccgcagatctggatcggcacc cggcacgtcggtggatgcgatgacctgttcgccctggagcgctccggtaaactcgatgcg ctgctgcacgtctga

DBGET integrated database retrieval system