Pseudomonas gorinensis: U771_02620 Help Entry U771_02620        CDS       T02969                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism psk  Pseudomonas gorinensis Pathway psk01100   Metabolic pathways psk01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:psk00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     U771_02620    00074 Mycolic acid biosynthesis     U771_02620   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     U771_02620 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF1493 Motif Other DBs NCBI-ProteinID:  AHC33085 LinkDB All DBs Position complement(580164..580418) Genome browser AA seq 84 aa AA seqDB search MQTRDDIFNTLRDALVELFELPPERVTLDANLYQDLEIDSIDAVDLIDHIKRQTGKKIAA EEFKAVRTVNDVVEAVYRLVQPAA NT seq 255 nt NT seq  +upstreamnt  +downstreamnt atgcaaactcgtgacgatattttcaacaccctgcgcgacgccttggtggaactgtttgaa ctgcccccggaacgcgtcaccctcgacgccaacctgtaccaggacctggaaatcgacagc atcgacgccgtggacctgatcgaccatatcaagcgccagaccggcaagaagatcgccgct gaggaattcaaggcagtacgcaccgtgaacgatgtggttgaggcggtgtaccgtctggtc cagccagccgcatga

DBGET integrated database retrieval system