Pseudomonas gorinensis: U771_24460 Help Entry U771_24460        CDS       T02969                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism psk  Pseudomonas gorinensis Pathway psk01100   Metabolic pathways psk01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:psk00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     U771_24460 (acpP)    00074 Mycolic acid biosynthesis     U771_24460 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     U771_24460 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1896 NirdL-like_HTH TerB Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  AHC37381 LinkDB All DBs Position complement(5389823..5390059) Genome browser AA seq 78 aa AA seqDB search MSTIEERVKKIVAEQLGVKEEEVINTASFVEDLGADSLDTVELVMALEEEFETEIPDEEA EKITTVQAAIDYVTSHQA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcaccatcgaagagcgcgtcaagaaaatcgttgccgagcaactgggcgtcaaagaa gaagaagtgatcaacactgcttccttcgtagaagacctgggtgccgattcccttgacacc gttgagctggtgatggctctggaagaggaattcgagaccgaaatcccggacgaagaagct gaaaaaatcactactgttcaagctgctatcgactacgttactagccaccaggcgtaa

DBGET integrated database retrieval system