Pseudomonas sp. KU43P: KU43P_11750 Help Entry KU43P_11750       CDS       T10397                                  Symbol ftsB Name (GenBank) cell division protein FtsB   KO K05589   cell division protein FtsB Organism pskp  Pseudomonas sp. KU43P Brite KEGG Orthology (KO) [BR:pskp00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:pskp03036]     KU43P_11750 (ftsB) Chromosome and associated proteins [BR:pskp03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     KU43P_11750 (ftsB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DivIC NRBF2 ACCA_BT HALZ YabA ZapB Motif Other DBs NCBI-ProteinID:  BBH44698 UniProt:  A0A5K7TTG2 LinkDB All DBs Position 1321307..1321588 Genome browser AA seq 93 aa AA seqDB search MRSPYWLFLVLLLLLGGLQYRLWVGNGSLAQVAELKQQIDEQHAENERLLERNRVLDAEV LELKKGMETVEERARHELGMVKEGETLFQLPQK NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atgcgcagtccctattggttgttccttgtcctgctcctgctgctcggtggcctgcagtac cgcctttgggtgggtaacggcagcctggcgcaagtggcagagctcaagcagcagatcgac gagcagcatgccgagaacgagcggctgctggaacgtaaccgcgtgctcgacgccgaggtg ctggagctgaagaaaggtatggagaccgtggaagaacgggctcgtcatgaattgggaatg gtcaaagagggcgaaaccctcttccagctgccgcaaaaatga

DBGET integrated database retrieval system