Pseudomonas sp. KUIN-1: KUIN1_03210 Help Entry KUIN1_03210       CDS       T09878                                  Name (GenBank) TIGR02449 family protein   KO K09892   cell division protein ZapB Organism psku  Pseudomonas sp. KUIN-1 Brite KEGG Orthology (KO) [BR:psku00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:psku03036]     KUIN1_03210 Chromosome and associated proteins [BR:psku03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     KUIN1_03210 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ZapB Motif Other DBs NCBI-ProteinID:  BBN61131 LinkDB All DBs Position complement(342917..343126) Genome browser AA seq 69 aa AA seqDB search MEDTDLQALMKRVELLLKYAEQLKGQNALLLAQEKTWREERAQLIEKNEIARQKVESMIS RLKALEQDS NT seq 210 nt NT seq  +upstreamnt  +downstreamnt atggaagacaccgacctgcaagcgctgatgaaacgtgtggagctgctcctgaagtatgcc gagcaacttaaaggccaaaacgcactcttattagctcaggaaaagacctggcgcgaggaa cgtgcccaactgattgaaaaaaacgaaatcgcccggcagaaggtcgagtcaatgatttcg cgccttaaagccctggagcaagactcatga

DBGET integrated database retrieval system