Pseudomonas sp. KUIN-1: KUIN1_04470 Help Entry KUIN1_04470       CDS       T09878                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism psku  Pseudomonas sp. KUIN-1 Pathway psku00998   Biosynthesis of various antibiotics psku01100   Metabolic pathways psku01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:psku00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     KUIN1_04470    00074 Mycolic acid biosynthesis     KUIN1_04470   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     KUIN1_04470 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  BBN61257 LinkDB All DBs Position complement(486723..486983) Genome browser AA seq 86 aa AA seqDB search MSDLHQDIKLLIIDALGLEDITPEDIGNDMTLFGEGLGLDSVDALELGLAIQKRYGIRID ADAKDTRNHFASVDSLAAFVSARQPA NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atgagcgatctgcaccaggacattaaattgttgatcatcgatgccctgggcctcgaagac atcaccccggaagatatcggcaacgatatgacgctgtttggcgaaggactgggactggac tcggtggatgcactcgaattgggcctggccatccagaagcgttatggcatcaggatcgat gccgatgcaaaggacacccgtaaccatttcgccagcgtcgacagccttgcggccttcgtc agcgccagacaaccggcctga

DBGET integrated database retrieval system