Pirellula staleyi: Psta_0245 Help Entry Psta_0245         CDS       T01147                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism psl  Pirellula staleyi Pathway psl01100   Metabolic pathways psl01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:psl00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Psta_0245    00074 Mycolic acid biosynthesis     Psta_0245   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Psta_0245 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding ACP_SdgA_C PP-binding_2 DUF1493 Ribosomal_L12_N DUF5783 Motif Other DBs NCBI-ProteinID:  ADB14941 UniProt:  D2R1F6 LinkDB All DBs Position 325701..325940 Genome browser AA seq 79 aa AA seqDB search MASVAERVIDIVADQLGVDKEKITPETSFVNDLGADSLDTVELVMELEEEFDINIPDDAA EKIQTVGQAIKFIEEAQNS NT seq 240 nt NT seq  +upstreamnt  +downstreamnt gtggcatccgtcgcagaacgagtgattgatatcgtcgccgatcagttgggcgtcgacaaa gaaaagattacgcccgaaacctctttcgtgaacgaccttggggccgactcgctcgacacc gtcgaactggtgatggaactggaagaagagttcgacatcaacattccagatgacgccgcc gagaagatccaaaccgttggtcaggcgatcaagttcatcgaagaagctcagaattcctaa

DBGET integrated database retrieval system