KEGG   Pirellula staleyi: Psta_0609
Entry
Psta_0609         CDS       T01147                                 
Name
(GenBank) sulfate ABC transporter, inner membrane subunit CysW
  KO
K02047  sulfate/thiosulfate transport system permease protein
Organism
psl  Pirellula staleyi
Pathway
psl00920  Sulfur metabolism
psl02010  ABC transporters
Module
psl_M00616  Sulfate-sulfur assimilation
Brite
KEGG Orthology (KO) [BR:psl00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    Psta_0609
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    Psta_0609
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:psl02000]
    Psta_0609
Transporters [BR:psl02000]
 ABC transporters, prokaryotic type
  Mineral and organic ion transporters
   Sulfate/thiosulfate transporter
    Psta_0609
SSDB
Motif
Pfam: BPD_transp_1
Other DBs
NCBI-ProteinID: ADB15296
UniProt: D2R4E8
LinkDB
Position
complement(757274..758158)
AA seq 294 aa
MSSLALGKKIPDRLNEPLWVRAILIAITLSFLTLMLLMPLGVVFWEAFSRGISAYFKSFQ
DPAAWSAIKLTLVATGIAVPLNLVFGLAAAWAIAKFDFPGKSILVTLIDLPFAVSPVVSG
LIYVLVFGMQGWFGETLDAWGIKVIFAVPGIVLATVFVTFPFVARELIPLMQEQGTDEEQ
AALVLGASGWQTFWYVTLPNIRWALVYGVILASARAMGEFGAVSVVSGHIRGKTNTLPLH
IEVLYNEFNVVAAFAAASLLTLLALVTLVIKSVVEWRLARERSEILKPSAAEGA
NT seq 885 nt   +upstreamnt  +downstreamnt
atgagttcactcgccctcggaaaaaagattcccgatcgcttgaacgaacctctgtgggtc
cgcgccatcttgattgcgatcaccctcagcttcctcacgctgatgctgttgatgcctctg
ggagtggtcttctgggaagcgttttcccgcgggatttccgcctatttcaagtcgtttcaa
gatccagctgcttggtccgccatcaagctcacgcttgttgcgaccggcattgcggtgccg
ctgaatctggtctttggcctggctgctgcgtgggccattgccaagtttgattttcccggc
aagagcatcctcgtcacgctgatcgatttgccgtttgctgtttcgccagttgtgtcggga
ctgatctatgtgctcgtcttcggcatgcaaggttggttcggagaaacgctcgacgcgtgg
gggatcaaagtcatttttgccgtgcctggcatcgtacttgcaacagtgtttgtcaccttc
ccgtttgtcgcgcgggaactgattccgctcatgcaagagcaggggacagacgaagaacaa
gcggcactcgtgctgggagccagtggctggcaaacgttttggtatgtcaccctcccgaac
attcgctgggcgctcgtctatggagtgatcctggcgagtgctcgcgcgatgggagagttt
ggagcggtgtcggtcgtcagtggacatatccgtggcaaaaccaacacgctccctctgcat
atcgaagtcctttacaacgaattcaatgtcgtcgccgcttttgcagctgcttcgctcctc
acactcttggcactagtgaccctggtgatcaagtcggtggtcgagtggcggttagcgcga
gaacggtccgaaatactcaagccgtcagcggcagagggagcttaa

DBGET integrated database retrieval system