KEGG   Pirellula staleyi: Psta_3310
Entry
Psta_3310         CDS       T01147                                 
Name
(GenBank) response regulator receiver protein
  KO
K03413  two-component system, chemotaxis family, chemotaxis protein CheY
Organism
psl  Pirellula staleyi
Pathway
psl02020  Two-component system
psl02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:psl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Psta_3310
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    Psta_3310
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:psl02022]
    Psta_3310
   02035 Bacterial motility proteins [BR:psl02035]
    Psta_3310
Two-component system [BR:psl02022]
 CheA family
  CheA-CheYBV (chemotaxis)
   Psta_3310
Bacterial motility proteins [BR:psl02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Psta_3310
SSDB
Motif
Pfam: Response_reg DUF5575
Other DBs
NCBI-ProteinID: ADB17974
UniProt: D2QXD4
LinkDB
Position
complement(4281834..4282196)
AA seq 120 aa
MAKRLLVTDDAIIIREIIKDTARKAGWEIVGEASNGQSAIEKYHELKPDAMTLDLVMPQY
DGLHALKGILSDDPNAKIVVVSALDQKNILKDAFKLGASDFIVKPFDHSKLMETLERLVA
NT seq 363 nt   +upstreamnt  +downstreamnt
atggcaaagcgacttcttgtaaccgacgatgcgatcatcattcgcgaaatcatcaaagac
actgcccgcaaagctggctgggaaattgtcggtgaggcgtcgaacggtcagtctgcgatc
gagaagtatcacgaattgaagcccgatgcgatgacgctcgatctcgtgatgcctcagtac
gacggtctccacgcactcaagggaatcttgagcgatgacccgaacgccaaaatcgtggtg
gtgagcgctctggatcagaagaacatcctgaaggatgccttcaaactcggtgccagcgat
tttatcgtcaagccgtttgatcattccaagctgatggaaacgctcgagcgacttgtcgcc
taa

DBGET integrated database retrieval system