KEGG   Pirellula staleyi: Psta_3768
Entry
Psta_3768         CDS       T01147                                 
Name
(GenBank) pantetheine-phosphate adenylyltransferase
  KO
K00954  pantetheine-phosphate adenylyltransferase [EC:2.7.7.3]
Organism
psl  Pirellula staleyi
Pathway
psl00770  Pantothenate and CoA biosynthesis
psl01100  Metabolic pathways
psl01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:psl00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    Psta_3768
Enzymes [BR:psl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.3  pantetheine-phosphate adenylyltransferase
     Psta_3768
SSDB
Motif
Pfam: CTP_transf_like Citrate_ly_lig
Other DBs
NCBI-ProteinID: ADB18423
UniProt: D2R058
LinkDB
Position
4901469..4901975
AA seq 168 aa
MTRSDSRVAVYTGSFDPITLGHLNVIERSSKLVDKLIVGIGINSEKSHLFPPEERVELVT
QATSQIGNVEVRAFSNLAVEFVRHCGARVMIRGVRPLTDLAGEFTMMMANRHLDPGIETV
FLMADEEFAHVSSSLIKQITPLASDEMLARFVPRSIIPALRQRIRGKS
NT seq 507 nt   +upstreamnt  +downstreamnt
atgaccaggtccgactcgcgcgttgctgtctacaccggttcgttcgatccgattacgctc
ggccatctgaatgtgattgagcggagttctaagctcgtcgacaaactgattgtcggcatc
ggcattaacagcgagaaatcacatctctttccacccgaagagcgtgtggaacttgtcacg
caggccacgtcgcagattggcaacgtcgaagttcgcgccttctcgaatttggccgtggaa
ttcgtacgccactgcggagcgcgggtgatgattcgtggcgtgcgaccgctcaccgatctg
gctggcgaattcaccatgatgatggccaaccggcacctcgatccagggatcgaaaccgtg
tttctcatggccgacgaagaattcgcccacgtcagcagttcgctcatcaaacagatcacg
ccgctggcgagcgacgaaatgctggcgcggttcgttccacgctcgattatccccgcgcta
aggcagcgcattcgcggaaaatcgtaa

DBGET integrated database retrieval system