Pseudoalteromonas sp. LC2018020214: JG479_06460 Help Entry JG479_06460       CDS       T10970                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism pslc  Pseudoalteromonas sp. LC2018020214 Pathway pslc01100   Metabolic pathways pslc01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pslc00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     JG479_06460 (acpP)    00074 Mycolic acid biosynthesis     JG479_06460 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     JG479_06460 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 TerB DUF1896 Motif Other DBs NCBI-ProteinID:  QQM65444 LinkDB All DBs Position 1:1463353..1463589 Genome browser AA seq 78 aa AA seqDB search MSDIQERVKKIIIEQLGVKEEEVKNESSFVDDLGADSLDTVELVMALEEEFDTEIPDEEA EKITTVQTAIDYVTAHAE NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcgatatccaagaacgcgtaaagaaaattatcattgaacaactaggtgttaaagaa gaagaagttaaaaatgaatcttctttcgtagatgacctaggtgcagattctcttgatact gttgaactagtaatggctcttgaagaagagtttgatactgagatcccagatgaagaagct gagaagatcactacagtacaaactgctatcgattacgtaacagcacacgctgagtaa

DBGET integrated database retrieval system