KEGG   Pseudarthrobacter sp. L1SW: KTR40_06790
Entry
KTR40_06790       CDS       T10267                                 
Symbol
truB
Name
(GenBank) tRNA pseudouridine(55) synthase TruB
  KO
K03177  tRNA pseudouridine55 synthase [EC:5.4.99.25]
Organism
psls  Pseudarthrobacter sp. L1SW
Brite
KEGG Orthology (KO) [BR:psls00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:psls03016]
    KTR40_06790 (truB)
Enzymes [BR:psls01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.25  tRNA pseudouridine55 synthase
     KTR40_06790 (truB)
Transfer RNA biogenesis [BR:psls03016]
 Eukaryotic type
  tRNA modification factors
   Psudouridine synthases
    KTR40_06790 (truB)
 Prokaryotic type
    KTR40_06790 (truB)
SSDB
Motif
Pfam: TruB_N TruB_C_2 TruB_C DKCLD PseudoU_synth_2
Other DBs
NCBI-ProteinID: UEL29812
LinkDB
Position
1474424..1475362
AA seq 312 aa
MLSGLVIVDKPQGWTSHDVVGRMRRLAGTRKVGHAGTLDPMATGVLVVGINKATRLLTYI
VGTSKTYTATIRLGQSTVTDDAEGEVTATAGTSAVSEQAIHDGVAALTGDIQQVPSSVSA
IKVNGERAYARVRSGEDVKLAARPVTIHRFEVHAIRRDREADVMDLDITVECSSGTYIRA
LARDLGNALGVGGHLTALRRTHVGPYSLEQARTLEQLAEELNVLDMADAARALMPNRELS
PEETTEISFGRRIAAGAAPGSPAAATADHPAAAFAPDGSLVALLADAGNFAKPVLVFAPG
NGSATVQDLGER
NT seq 939 nt   +upstreamnt  +downstreamnt
gtgctttctggactggtgatagtggacaagccgcagggatggaccagccatgatgtggtt
ggccggatgcggcgcctcgcaggtacccggaaagtagggcatgccggaaccttggatccc
atggccacgggcgtcctggtagtgggcatcaacaaagccacccgcctgctcacgtatatc
gtgggcacttccaagacctacaccgccaccatccgcctgggccagtccacagtcacggac
gacgccgagggcgaggtcaccgcgacggcaggcacatcggcggtaagcgagcaggcaatc
cacgacggcgtcgcagcgcttaccggggacatccagcaggtgcccagcagcgtcagcgcc
atcaaggtcaacggggaacgggcctatgcgcgggtccgctccggtgaggacgtgaagctt
gccgcccgccccgtcaccatccaccgcttcgaggtgcacgccatccgccgggaccgggaa
gcggacgtcatggacctggatatcaccgtggaatgctcctccgggacctacatccgcgcc
cttgcccgcgacctgggcaacgcgctgggagtgggcggacacctcaccgcgctccgccgg
acgcacgtgggcccgtactccttggagcaggcgcgaacgctggaacagcttgccgaggag
ctcaacgtcctggacatggccgacgccgcacgggcgctgatgcccaaccgcgagctcagc
cctgaggaaaccaccgaaatctcgttcggacggcggatcgctgccggcgccgcccccggc
agccccgccgcggccaccgccgaccaccccgcagccgccttcgcgccagacggaagcctg
gtagcgctcctggccgatgccggcaacttcgccaagcccgtgctggtgtttgcccccggc
aacggcagtgccacggtccaggacctcggtgaacgctga

DBGET integrated database retrieval system