Pseudarthrobacter sp. L1SW: KTR40_11015 Help Entry KTR40_11015       CDS       T10267                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism psls  Pseudarthrobacter sp. L1SW Pathway psls01100   Metabolic pathways psls01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:psls00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     KTR40_11015    00074 Mycolic acid biosynthesis     KTR40_11015   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     KTR40_11015 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L50 Ag332 Motif Other DBs NCBI-ProteinID:  UEL27170 LinkDB All DBs Position 2388665..2388910 Genome browser AA seq 81 aa AA seqDB search MASNEEILAGLAEIVNEETGLAPEAVELDKSFTEDLDIDSISMMTIVVNAEEKFGVRIPD EEVKNLKTVGDAVSFIAGAQA NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atggctagcaacgaagagatcctggccggcttggctgaaatcgtcaacgaggaaaccggc ctggcccccgaggccgtggagctggacaagtccttcaccgaggacctggacatcgactcc atctccatgatgaccattgtggtcaacgccgaggaaaagttcggcgtccgcatccccgac gaagaggtcaagaacctcaagaccgtcggcgacgccgtcagcttcatcgccggagcgcag gcctag

DBGET integrated database retrieval system