Pseudomonas sp. MM213: K5R88_23320 Help Entry K5R88_23320       CDS       T11312                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism psmd  Pseudomonas sp. MM213 Pathway psmd01100   Metabolic pathways psmd01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:psmd00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     K5R88_23320    00074 Mycolic acid biosynthesis     K5R88_23320   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     K5R88_23320 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  UCP08718 LinkDB All DBs Position complement(5123461..5123721) Genome browser AA seq 86 aa AA seqDB search MSDLHREIKLLIIDALGLEDISVEDIGNDQTLFGEGLGLDSVDALELGLAIQKKYGIKID ADAKDTRNHFSNVASLAAFVTAKQAA NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atgagcgatctgcaccgtgaaataaaactgttgatcatcgacgcccttggcctcgaagac atcagcgtcgaagacatcggcaatgaccagacgctgttcggtgaaggcctgggcctggac tccgtcgacgccctggaactcggcctggcgatccagaaaaagtacggcatcaaaatcgat gccgacgccaaggacacccgcaatcacttcagcaacgtggcgagccttgcggcgttcgtc actgcaaaacaggcagcttga

DBGET integrated database retrieval system