Pseudoalteromonas sp. MM1: PspMM1_13390 Help Entry PspMM1_13390      CDS       T09926                                  Symbol acpP_1 Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism psmm  Pseudoalteromonas sp. MM1 Pathway psmm01100   Metabolic pathways psmm01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:psmm00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     PspMM1_13390 (acpP_1)    00074 Mycolic acid biosynthesis     PspMM1_13390 (acpP_1)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     PspMM1_13390 (acpP_1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 TerB DUF1896 Motif Other DBs NCBI-ProteinID:  BED88871 LinkDB All DBs Position 1:1510719..1510955 Genome browser AA seq 78 aa AA seqDB search MSDIQERVKKIIIEQLGVKEEEVKNEASFVDDLGADSLDTVELVMALEEEFDTEIPDEEA EKITTVQSAIDYVSAHAE NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcgatatccaagaacgcgtaaaaaaaattatcatcgaacaactaggtgttaaagaa gaagaagttaaaaacgaagcttctttcgtagatgacctaggtgcagattctcttgatact gttgaactagttatggctctagaagaagagtttgatactgagatcccagatgaagaagct gaaaagatcactacagtacaatctgcaatcgattacgtatcagctcacgctgagtaa

DBGET integrated database retrieval system