Pseudomonas sp. MT-1: MT1_4203 Help Entry MT1_4203          CDS       T10396                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism psmt  Pseudomonas sp. MT-1 Pathway psmt01100   Metabolic pathways psmt01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:psmt00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     MT1_4203    00074 Mycolic acid biosynthesis     MT1_4203   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     MT1_4203 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding M2AP_beta_dom Motif Other DBs NCBI-ProteinID:  BAP81376 LinkDB All DBs Position 4565456..4565728 Genome browser AA seq 90 aa AA seqDB search MSQLQLEIKQLIIDALGLEDLGPDDIAADQPLFGEGLGLDSVDALELGLAIQKRFGIKID ADAKDTRKHFASVDSLTAYVSANRAVTEEA NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgagccaactgcagcttgaaatcaagcaactgatcatcgacgccctgggtctggaagac cttggcccggacgacatcgcggccgaccagccgctgtttggcgaagggctcgggctggat tcggtcgatgcgctggagctgggtctggcgatccagaagcgcttcggcatcaagatcgac gccgatgcgaaggacacccgcaagcatttcgccagtgtcgatagcctgaccgcctacgtc agcgccaaccgcgccgtcaccgaggaggcttga

DBGET integrated database retrieval system