Pseudomonas sp. ML2-2023-6: V6L79_01200 Help Entry V6L79_01200       CDS       T10713                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism psmz  Pseudomonas sp. ML2-2023-6 Pathway psmz01100   Metabolic pathways psmz01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:psmz00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     V6L79_01200    00074 Mycolic acid biosynthesis     V6L79_01200   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     V6L79_01200 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding ACP_SdgA_C DUF1493 DUF6792 Motif Other DBs NCBI-ProteinID:  WWT66622 LinkDB All DBs Position 292661..292915 Genome browser AA seq 84 aa AA seqDB search MQTRDDIFNTLRDALVELFELEPERVTLDANLYQDLEIDSIDAVDLIDHIKRKTGKRIAA EEFKSVRTVNDVVEAVYRLVHADA NT seq 255 nt NT seq  +upstreamnt  +downstreamnt atgcaaacccgtgacgacattttcaataccctgcgcgacgctctggttgaactctttgaa cttgaacccgagcgcgtcaccctggacgccaacctgtatcaggacctggaaatcgacagc atcgatgccgtagacctgatcgatcacatcaagcgcaaaaccggcaagcgaatcgccgct gaagaattcaaatcggtgcgaaccgtaaatgacgtggtcgaggcggtttaccgtctggtt cacgcagacgcatga

DBGET integrated database retrieval system