Pseudarthrobacter sp. NIBRBAC000502771: NIBR502771_14200 Help Entry NIBR502771_14200  CDS       T06121                                  Name (GenBank) mycoredoxin   KO K18917   mycoredoxin [EC:1.20.4.3] Organism psni  Pseudarthrobacter sp. NIBRBAC000502771 Brite KEGG Orthology (KO) [BR:psni00001]  09190 Not Included in Pathway or Brite   09191 Unclassified: metabolism    99980 Enzymes with EC numbers     NIBR502771_14200 Enzymes [BR:psni01000]  1. Oxidoreductases   1.20  Acting on phosphorus or arsenic in donors    1.20.4  With disulfide as acceptor     1.20.4.3  mycoredoxin      NIBR502771_14200 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin Thioredoxin_2 Thioredoxin Glrx-like GST_N_2 GST_N_3 Flagellin_IN Thioredoxin_7 Motif Other DBs NCBI-ProteinID:  QDG63354 LinkDB All DBs Position complement(3029403..3029660) Genome browser AA seq 85 aa AA seqDB search MDFTPESGTITMFSTTWCGYCNRLKKQLDAQGIGYTEINIEEVDGTAELVEQLNGGNRTV PTVLFPDGSAATNPSAAEVKSRLAA NT seq 258 nt NT seq  +upstreamnt  +downstreamnt gtggacttcactcccgaatccggcaccatcaccatgttttccaccacgtggtgcggctac tgcaaccggctcaagaagcagctggacgcccaggggatcggctacaccgaaatcaacatc gaagaggtggacggcactgccgaactcgtggagcagctgaacggcggcaaccgcaccgtc cccacggtcctcttcccggacggcagcgcggccaccaacccgtccgccgccgaggtcaag agccgcctggccgcctga

DBGET integrated database retrieval system